KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_217516Help
Entry
BRAFLDRAFT_217516 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    BRAFLDRAFT_217516
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bfo03036]
    BRAFLDRAFT_217516
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     BRAFLDRAFT_217516
Chromosome and associated proteins [BR:bfo03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     BRAFLDRAFT_217516
   HDAC complexes
    Sin3A-HDAC complex
     BRAFLDRAFT_217516
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    BRAFLDRAFT_217516
  Chromatin remodeling factors
   NuRD complex
    BRAFLDRAFT_217516
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl RNA_polI_A34
Motif
Other DBs
NCBI-GeneID: 7211276
NCBI-ProteinID: XP_002594632
JGI: 217516
UniProt: C3ZA55
LinkDB All DBs
AA seq 462 aa AA seqDB search
MAYTQPAGKRKICYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
SFEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLYEFCQLSTGGSVA
GAVKLNKQQADIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYVDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPLRDGIDDEAYEH
IFEPVMSKVMEMYQPSAIVLQCGADSLSGDRLGCFNLSLKGHGKCVEFMKKFNIPILMLG
GGGYTIRNVARCWTFETSIALGCDVANELPYNDYFEYYGPDFKLHISPSNMTNQNTPEYL
EKIKQRLFENLRMLPHAPGVQMQAIPEDAIDQESEDNEEEDPDKRVSIRAQDKRITCDEE
FSDSEDEGEGGRRDHHSHKKRKRLQREEDKKEEDKKTGLCCN
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacacacaaccggctggaaagcggaaaatctgctactactacgatggtgacatt
ggcaactactactatggccagggtcaccccatgaagccacatcgaatccgcatgacccac
aacctgttactcaactatggactctatcgaaagatggaaatctaccgaccacacaaggcc
tcttttgaagagatgactaagtaccacagcgatgactacatcaagttcctccgttccatc
cggccggacaacatgtctgagtacagcaaacagatgcagagattcaatgtaggagaggac
tgcccggtgtttgatgggctatatgagttctgccaactgtcaacaggaggatctgttgct
ggtgcagtgaagttgaacaagcagcaggctgatatagcagtcaactgggctggtggtctt
caccacgccaagaagtccgaggcctctggattctgctatgtcaacgacattgttctcgcc
atccttgaactgctcaagtaccaccagcgtgtgttgtatgtggacattgacatccaccac
ggggacggtgtggaggaggctttctacacgacagaccgcgtcatgactgtgtccttccac
aagtacggggagtacttcccaggaactggtgacctcagggacattggtgcaggaaagggg
aaatactacgccgtcaactttccgctacgggacgggattgacgacgaagcgtatgaacac
atattcgagccagtcatgtccaaggtgatggagatgtaccagcccagtgccatagtactg
cagtgtggggcagactctctgtcaggggacaggctgggctgcttcaacctctcgctcaaa
ggtcacgggaaatgtgtagagttcatgaaaaagttcaacattcctatcctgatgctggga
ggaggcggctacaccatccgtaacgtggcgcgctgctggaccttcgagacatccatcgct
ctggggtgtgacgttgccaatgagctgccctacaacgactattttgaatattatggccca
gacttcaagttgcacatcagtccatcaaacatgaccaaccagaatacaccggagtacctg
gagaagatcaaacagcgattgttcgagaacttgagaatgttacctcatgcacctggtgtt
caaatgcaagctattcctgaggatgccatagaccaggagagtgaagacaatgaagaagag
gacccagacaagcgtgtatcaattcgtgcccaggacaagcgcatcacctgcgatgaggag
ttctctgacagcgaggatgagggtgaaggcggaagacgtgaccaccacagccacaagaag
cggaaacggttgcagagggaggaagataagaaggaggaagacaaaaagacaggtttgtgt
tgcaactaa

DBGET integrated database retrieval system