KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_246631Help
Entry
BRAFLDRAFT_246631 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bfo01002]
    BRAFLDRAFT_246631
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bfo04147]
    BRAFLDRAFT_246631
   04090 CD molecules [BR:bfo04090]
    BRAFLDRAFT_246631
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     BRAFLDRAFT_246631
Peptidases [BR:bfo01002]
 Metallo Peptidases
  Family M2
   BRAFLDRAFT_246631
Exosome [BR:bfo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BRAFLDRAFT_246631
CD molecules [BR:bfo04090]
 Proteins
  BRAFLDRAFT_246631
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 7218275
NCBI-ProteinID: XP_002594681
JGI: 246631
UniProt: C3Z9J6
LinkDB All DBs
AA seq 1145 aa AA seqDB search
QVEASLAEAAFDKEVAQNASRFDWQNFNNATLKRLFDKISGLGTAAQTDQAKLEELNNLL
SEMDNIYSTGEACEYDDPSNCLALNPDLYDCLASSRDYDRLRFCWEGWRDAVGRQLKDKY
PRFVELSNDAVSQDAQNWEDTGAYWRSWYETDDFQEQLENLYNQLQPLYNNLHAYVRKKL
REQYGEDKISATGPIPAHLLGNMWSQSWINIYDLVEPYPGKTSLDVTPKMLADGWTVDRM
FRTSDNFFTDMGQVGMPQNFWENSMFVKPPDKDVVCHASAWDFYNAHDVRVKMCTNINMD
DLVTIHHEMGHIEYYLQYKHQPVPFRRGGNPGFHEAVGDLLALSVSTPTHLQGIGLLDTV
DDDDQSDINFLMSMALDKVSFLPFGYLMDQWRWGVFNGSITPATYNQEWWKLRTHYQGIV
PPIPRNNAKDFDPGCKFHIPGNTPYIRYFVSFIVQFQFHKALCDTSGHTGPLHKCDISAG
PNKAAAGEKLAQMLQMGSSQMWPDAMEVITGQRTMSAQPILDYFQPLITWLEQQNQGERL
GWDESWTPTSQNVAPQGITDEQQAWDFIWDYNAKAEKVYYDSVVAAWNYNTDLTQENSQK
QIEASLAEARFHKEVAQNASRFDWQNFNNATLKRLFDKISGLGTAAQQDQAKLEELNNIL
SEMDNIYSTGKACEYDDPSNCLSLNPDLYSCMASSRDYDRLRFCWEGWRDAVGRKLKDKY
PRFVELTNDAVTQNWADTGAYWRSWYDIPDFQEQLENLYNQLQPLYNNLHAYVRKKLREQ
YGQDKISASGPIPAHVLGNMWSQSWINIYDLVEPYPGKTNIDVTPKMKADGWTVDRMFRT
SDDFFKDMGQIEMPQNFWDNSMFVKPADRDVVCHASAWDFYNAHDVRIKMCTNINMMDLI
TIHHEMGHIEYFLQYKHHPVPFRGGANPGFHEAVGDLLALSVSTPKHLQSIGLLDTVEDD
NGKLYGRGSYFLMLLSYATEESAWRLGTPTGPINTHNLNCNNMQTRYQGIVPPIPRNHAK
DFDPGCKFHIPANAPYIRYFVSFILQFQFHKALCNISGHTGPLHKCDISAGPNKAAAGEK
LAQMLQMGSSQVWPDAMEVITGQRTMSAQPLVDYFQPLITWLEQQNQGEILGWDESWTPP
CEYRS
NT seq 3438 nt NT seq  +upstreamnt  +downstreamnt
caggttgaagccagcttagcagaagcagcgttcgacaaagaagtggctcaaaatgcctcc
aggtttgactggcagaacttcaacaatgcaacactgaagagactcttcgataaaatcagc
ggccttggaaccgcagctcagactgaccaggcgaagctggaggagctcaacaacttactc
tctgagatggacaacatttactccactggggaagcatgcgagtatgacgacccgtcaaac
tgtctggcgttgaacccagatttgtacgactgtctggccagcagccgtgactacgaccgg
ctgcggttctgctgggaaggctggcgggacgcggtgggcagacagctgaaggacaaatac
ccacgcttcgtggagctcagtaacgatgctgtcagtcaagacgctcagaactgggaagac
accggtgcctactggcgctcctggtacgagacagatgactttcaggagcagctggagaac
ctgtacaaccagctccagcccctgtacaacaacctgcacgcttacgtcaggaagaagctg
agggaacaatacggagaggacaagatcagtgctactggacccatccctgcacatctattg
ggtaacatgtggtctcagtcatggatcaacatctacgaccttgtagaaccttaccctggc
aagaccagccttgatgtgacaccgaagatgctggcagatggatggacagttgatcggatg
ttccgcacatcagacaacttcttcacggacatgggtcaagttgggatgccgcagaacttt
tgggagaactccatgttcgtcaaaccaccagacaaagatgtggtctgtcacgcgtcagca
tgggacttctacaacgctcatgatgtcagggttaagatgtgcaccaacataaatatggac
gatctggtcaccatccaccacgagatgggacacatcgagtactacctacagtacaaacat
cagcctgttccattccggcgtggggggaacccgggttttcatgaagcagtgggagatctg
ctggctctgtccgtgtccactccaacacacttacagggtatcggcctcctagacacagtg
gatgacgacgatcagtctgacatcaacttcctgatgagtatggccctggacaaggtttcc
ttcctgccgttcggatatctgatggaccagtggagatggggagttttcaacggctctatt
actccagcaacctacaaccaggagtggtggaaacttaggactcattaccagggcatcgtg
ccacctatcccgaggaacaacgccaaagattttgaccccggatgcaaattccacatccct
ggcaacaccccttatatcaggtacttcgtgagcttcatcgttcagttccagttccacaag
gccctgtgtgatacttccggacacaccggtccgctgcacaagtgtgacatctctgcaggg
cccaacaaggcagccgctggggaaaaactggcccaaatgctccagatgggatctagtcag
atgtggccggacgccatggaggtgatcaccggtcaaagaacgatgtcagctcagccaatc
ctggactacttccagccactcatcacatggttggaacaacagaaccagggagagagactc
ggctgggacgaaagctggacccctacttctcagaatgtcgctcctcagggcatcacagac
gagcagcaggcctgggacttcatttgggactacaacgctaaagctgagaaggtttactat
gatagtgtagtggccgcgtggaactacaacacggacctcacacaggagaatagccagaaa
cagattgaagccagcttagcagaagcacggttccataaagaagtggctcaaaatgcctcc
aggtttgactggcagaacttcaacaatgcaacactgaagagactcttcgataaaatcagc
ggccttggaaccgcagctcagcaggaccaggcgaagctggaggagctcaacaacatactc
tctgagatggacaacatttactccactgggaaggcgtgcgagtatgacgatccgtcaaac
tgtctatcgctgaacccagatttgtacagctgcatggccagcagccgtgactacgaccgg
ctgcggttctgctgggaaggctggcgggacgcggtgggcaggaagctgaaggacaaatac
ccacgcttcgtggaactcactaacgatgctgtcactcagaactgggcagacaccggtgcc
tactggcgctcctggtatgacatacctgactttcaggagcagcttgagaacctgtacaac
cagctccagcctctgtacaacaacctgcacgcttatgtcaggaagaagctgagggaacaa
tacggacaggacaagatcagtgccagtggaccaatccctgcacatgtgttgggtaacatg
tggtctcagtcctggatcaatatctacgaccttgtggagccttaccctggcaagaccaat
attgacgtgacaccaaagatgaaggccgatgggtggacagttgatcggatgttccgcaca
tcagacgacttttttaaggacatgggtcaaatcgagatgccgcagaacttttgggacaac
tccatgttcgtcaaaccagcagacagagatgtggtctgtcacgcgtctgcatgggacttc
tacaacgctcatgatgtcaggattaagatgtgcactaacataaacatgatggacctgatc
accatccaccacgagatggggcacatcgagtacttcctacagtacaagcatcaccctgtc
ccgttccggggtggagcaaacccgggtttccatgaagcagtgggagatctgctggctctg
tccgtgtccactccgaaacacctacagagcatcggcctcttggacactgtggaagacgac
aacggtaagctttacggtagaggatcttattttcttatgttactgtcttatgccacggag
gaatctgcttggagattaggtacaccaacaggaccaataaatactcataatttaaattgc
aacaatatgcagactcgttaccagggtatcgttccacctatcccgaggaaccacgccaaa
gattttgaccccggatgcaaattccacattcctgccaacgccccttatatcaggtacttc
gtgagcttcatccttcagttccagttccacaaggccctgtgtaatatttccggacacacc
ggtccgctgcacaagtgtgacatctctgcagggcccaacaaggcggccgctggggaaaaa
ttggcccaaatgctccagatggggtccagtcaggtgtggccggacgccatggaggtgatc
accggtcaaagaacgatgtcagctcagccgctcgtggactacttccagccactcatcaca
tggttggaacaacagaaccagggagagatactcggctgggacgaaagctggactcctcct
tgtgagtacagatcatga

DBGET integrated database retrieval system