KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_260918Help
Entry
BRAFLDRAFT_260918 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
Organism
bfo  Branchiostoma floridae (Florida lancelet)
SSDB OrthologParalogGFIT
Motif
Pfam: RIB43A
Motif
Other DBs
NCBI-GeneID: 7215285
NCBI-ProteinID: XP_002597293
JGI: 260918
UniProt: C3Z2Q4
LinkDB All DBs
AA seq 379 aa AA seqDB search
MYKLDLPVDLKQAAAIERRRNMEKQRQSRIFNAKERIIGVDVQALEQQRKDREVREETEA
ARAEAFAADAIKNDKVVVMMEKRQEQDIRNLNMAVNDFRKNFQVPETRREFDLNDPDGLK
KDRPARLTDDDPRCGISGIQKLDGEDLNFTARKKYQQEQMREWTKAQIKERNAADMNQKH
ADLLYEMKARELDQRACELATAEEECRRQINMATKNFNLAQQREKDEQEAMKRQQQLDDN
YTELSNHIYGDMLTENPAVAQSAFGAHRVITDRWKGMSPEQLADVRNRQEQQRQEKERLE
MEERLRNEEWDKQRVDADRAAVILERREERLKKELERQQAQENLRLGAEQKAHMGFMDKE
VYTNEPTAQYFMQFNKSSR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagttggatcttcctgtagacttgaaacaggctgcggccatagagcggcggcgg
aacatggaaaaacaacgccagagccgcatcttcaatgccaaagagaggataattggggtt
gatgtacaggctctggaacagcagaggaaagacagagaggtcagagaggagacagaagca
gctcgggcagaggcctttgctgctgatgccattaaaaatgacaaggttgtagtaatgatg
gaaaaacggcaagagcaggacattcgcaatctcaacatggccgtcaacgacttccgtaag
aacttccaggttcctgagacacggcgtgagtttgacctgaatgaccctgatggcctgaag
aaggacaggccagcacgattgacagatgacgaccctcgctgtggtatcagtggtatccag
aaactggatggagaggatctgaacttcacagccaggaaaaagtaccaacaggaacaaatg
cgcgagtggacgaaggcccagatcaaggagcgcaatgctgcggacatgaaccagaagcac
gcggatctgttgtacgagatgaaggcacgtgagctggatcagcgggcatgtgaactggcc
acagctgaggaggaatgcagacgtcagatcaacatggcgaccaagaacttcaacctggca
cagcaacgtgagaaggatgagcaggaggctatgaagaggcagcagcaactagatgacaac
tacactgagctgtccaatcacatctatggagacatgcttacggagaaccctgccgtggca
cagagcgcgtttggcgcccaccgtgtcatcaccgacaggtggaaggggatgagccctgag
cagcttgctgacgtccgcaacagacaggaacagcagaggcaagagaaggagcgcctggaa
atggaggaacgtctgagaaacgaggagtgggacaaacagcgtgtggatgccgaccgagca
gccgtcatcctggagagaagagaggagcgtctgaagaaggaactcgagaggcagcaagcc
caggagaatctacgacttggtgcagagcagaaggcacacatgggtttcatggataaggag
gtttacaccaatgaaccaacagctcagtacttcatgcagttcaacaaatccagtcggtga

DBGET integrated database retrieval system