KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_273662Help
Entry
BRAFLDRAFT_273662 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00020  Citrate cycle (TCA cycle)
bfo00190  Oxidative phosphorylation
bfo01100  Metabolic pathways
bfo01200  Carbon metabolism
Module
bfo_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BRAFLDRAFT_273662
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BRAFLDRAFT_273662
Enzymes [BR:bfo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BRAFLDRAFT_273662
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_18 Fer2
Motif
Other DBs
NCBI-GeneID: 7237275
NCBI-ProteinID: XP_002590428
JGI: 273662
UniProt: C3ZLV8
LinkDB All DBs
AA seq 278 aa AA seqDB search
MASVLNKSVALWSASRQPMIVALQLSRGAQTAAAAAPQEQPRLKKFKIYRWDPDKMGDKP
RMQEYSVDLNNCGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIGGTNTLACISR
IDTKLSKATKIYPLPHMYVVKDLVPDMSNFYAQYRSIEPYLKRKDGIQQGEEQLFQSVDD
RAKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDQFRKERLEKLQD
PFSVYRCHTIMNCTKTCPKGLNPGRAIAEIKKMMAGLA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgttttgaacaagtcggtggctctttggtctgcgtcaagacagcccatgatt
gtagccttacagttgagccgaggagcccagacagcagcagcagctgcaccccaagaacag
cccagactaaagaagttcaagatctacagatgggaccctgacaagatgggagacaagccg
aggatgcaggagtatagcgtggatttgaacaactgtggccccatggttttagatgctctc
atcaaaatcaagaatgagattgaccccactctgaccttcagacgatcatgcagagaaggc
atctgtggctcctgtgccatgaacattggtggcaccaacactcttgcctgcatcagtcgc
attgacaccaaactgagcaaggccaccaagatctaccccctgcctcacatgtacgtggtg
aaggaccttgtacctgatatgtccaacttctatgcccagtacagatctattgagccatac
ctgaagaggaaggatggcatacaacagggagaggagcagctcttccagagtgtggatgat
agagcaaagctggacggcctgtatgagtgtatcctgtgtgcgtgttgctccacctcctgt
cccagctactggtggaacggagacaagtacctgggccccgccgtgctgatgcaggcctac
cgctggatgattgacagcagagatcagttccgtaaggagcgtctggagaagctgcaggac
ccattctccgtgtaccgctgtcataccatcatgaactgcaccaagacttgtccgaagggc
ctgaacccaggcagggcgattgctgagatcaagaagatgatggctgggcttgcataa

DBGET integrated database retrieval system