KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_59355Help
Entry
BRAFLDRAFT_59355  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    BRAFLDRAFT_59355
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bfo01002]
    BRAFLDRAFT_59355
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bfo04147]
    BRAFLDRAFT_59355
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     BRAFLDRAFT_59355
Peptidases and inhibitors [BR:bfo01002]
 Serine peptidases
  Family S1: chymotrypsin family
   BRAFLDRAFT_59355
Exosome [BR:bfo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BRAFLDRAFT_59355
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 7234929
NCBI-ProteinID: XP_002596017
JGI: 59355
UniProt: C3Z5B6
LinkDB All DBs
AA seq 217 aa AA seqDB search
MTSYHFCGGSLIHPQWILTAAHCFADDPNPSRYNVVLGKHLSDGSEPTQETFGLTRVIVH
EEYNDNLINKDLTLLKLDRPATLGQYIHIACLPEHANDDPPAGTTCVTTGWGDTQGTGDD
HQLKQARVPLVSNDDCNAANSYDGEITEFMMCAGFQEGGHDACQGDSGGPLVCPRQGKWY
LNGVVSWGYGCAQPNYPGVYARVTSMLDWVLDKMANN
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgacctcctaccacttctgcggcgggtccctcatccacccccagtggatcctgacagcc
gctcactgcttcgctgacgacccaaatccaagcagatacaacgtcgttcttggcaagcat
ctctctgacggaagtgagccaactcaggaaaccttcggcctgacaagggtcatcgtccac
gaagaatacaacgacaacctgatcaacaaggatctgaccctgctgaagcttgaccgtccc
gccacccttggccagtacatccatatcgcctgtctgcccgagcacgccaatgacgatcct
cctgctggtaccacatgtgtcaccaccggatggggagacacccagggtactggcgacgat
caccaactgaagcaggcccgcgttcctctggtcagtaacgacgactgtaacgccgccaat
tcctacgacggagagatcaccgagttcatgatgtgcgctggcttccaggagggagggcac
gatgcttgccagggtgactccggtggcccgctggtctgcccccgccagggcaagtggtac
ctgaacggtgtggtgagctggggctacggctgtgcccagcctaactaccccggcgtgtac
gcccgtgtcacctctatgttggactgggttctcgacaagatggctaacaactag

DBGET integrated database retrieval system