KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_65433Help
Entry
BRAFLDRAFT_65433  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00052  Galactose metabolism
bfo00500  Starch and sucrose metabolism
bfo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BRAFLDRAFT_65433
   00500 Starch and sucrose metabolism
    BRAFLDRAFT_65433
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BRAFLDRAFT_65433
    3.2.1.20  alpha-glucosidase
     BRAFLDRAFT_65433
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF2116 SNARE
Motif
Other DBs
NCBI-GeneID: 7212961
NCBI-ProteinID: XP_002592852
JGI: 65433
UniProt: C3ZDQ7
LinkDB All DBs
AA seq 373 aa AA seqDB search
MYQKQDDYDELAEATLMQTEYRPRRKNRRPCLIFFCIVVVFLAIIIPVAIVASNRSHGTS
GYVTPECPSGDERERVDCYPEGGASKARCESRGCCWAQPTTQGPPSCFYPVNHGYELVGG
LQSTPIGYRATLRRLNTQTMYGGDLGNIEVVVEVQEDYRLHVKVSDPTRPRYEVPEAALK
RPQATTLAEHPLYNLTFTSNPFSIKVTRRSTGATIFDTSVGKLTFSDQFLSVSTRLASPN
LYGLGEHVHRRYRHDLNWKTWPFFTRDSSPAAGNSDNLYGQHPFYMCVEEDGNANGVFLL
NSNAMDVTLQPGGPDSAPIVTYRVIGGVLDFYMFLGPSPENVVQQYTEVGLYIYFSSLKR
FSCSVSMCLYLFS
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgtaccaaaaacaagacgattacgatgaattggcggaagcaactctcatgcagaccgag
tacaggccaaggaggaagaatcggcgaccatgtttgatattcttctgcatcgtggttgtt
tttctcgccattataatccccgtagcgatcgtagccagcaacagaagccacgggacgagc
gggtacgtgacaccggagtgcccgagcggtgacgagcgggagagagtcgactgctacccc
gagggaggggcgagcaaggcccggtgcgagtctcggggatgctgctgggcccaacccacc
acccaaggcccgcctagctgcttctaccccgttaaccacgggtacgagctggtagggggc
ctgcagagtacacccatcgggtacagggccaccctccgccgcctgaacacccagactatg
tacggtggcgacctgggaaacatcgaggtggtggtggaagttcaggaggactatcggctt
catgtcaaggtgtctgacccgacgcgccctcggtacgaggtgcccgaggccgcactgaag
cgcccccaagcgacgaccttggcagagcacccactgtacaacttgaccttcaccagcaac
ccctttagtatcaaggtcacgaggagaagcacaggggccactatattcgacacctctgtg
ggaaagctgacgttttccgaccagttcctgtccgtgtccacccggctggccagccctaac
ctgtacggactgggggagcacgtccacaggcgctacaggcacgacctcaactggaaaact
tggccgttcttcacaagggactcgtcgcctgcagcagggaattcggataatctgtacggg
cagcacccgttctacatgtgtgtggaagaagacggcaacgcgaatggcgtcttcttgctc
aacagcaacgctatggatgtgaccctccaacccggtggcccagactccgcccccatcgtg
acgtaccgcgtgattggcggggtgttggacttctacatgttcctcggaccctccccggaa
aacgtcgtgcagcagtacacagaggtaggactatacatttacttttcttctttaaaaaga
ttttcatgttctgtatcaatgtgcttatacttattttcataa

DBGET integrated database retrieval system