KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_66773Help
Entry
BRAFLDRAFT_66773  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K20353  COPII coat assembly protein SEC16
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bfo04131]
    BRAFLDRAFT_66773
Membrane trafficking [BR:bfo04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    BRAFLDRAFT_66773
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec16_C Sec16
Motif
Other DBs
NCBI-GeneID: 7226518
NCBI-ProteinID: XP_002600268
JGI: 66773
UniProt: C3YU03
LinkDB All DBs
AA seq 2645 aa AA seqDB search
MADQPADDSAQFHGGYAQPQPAQGWPPQDSAQKPAFFNPQQMPAPASGPPMFFNPASFDT
AAVPPFLPQQGPAHPPQQWDHPTYPPQQQQPTWNSHEVQNGPPHQGGYQGGNVQQNEYTQ
QHYSNWQEQDLYAPPVSDPLADSRASSSFYESSGQSSTLGFNFSSENPSLNSSERTSPML
AAGDYGQGGYPYDGSGMEIPRDGMQQPPSEGAAMFRQPEGNSVPNDSGPVGQYFSSPGNT
NAAPVPASMPQVSMFNPQFGLPEESRSAASLGQEEGAEYRGEGTLTRELTGQEQEQPAEN
VQHFPPPQNNQPPLHHPNLDGSQTGPENSSWDFGGAPHQEMRRELTGQEDGLDSQPQDPA
QFALQPPGPQQAPPVLTVEEPAAGVPTPSPGVPTTSPGHSRSSSQQFDAISLGSGKEGNA
SRSGSRASSLIVEGQAQPSVTPGGGSTNSGTREDFDAGTRPVGDHSRSGSVDSGRSVPGI
VDGPPPQSVVGQPETAGGMARSRSGSAESGRSARSNRSTSSVPPPPPLNVPYQEGAAMER
SRSGSAESGRSGSSGRPPSLSRHNRAESNDSIHSAGSNPALSSQPPLMEEQSPGDGAPSP
QPTQTIRPSDVGPGDSPEGAASPDEPTQPQQGDGEPEPPPQNTRPPQARPSGHSPPPPSR
PSIPNFPIFSPMEGSMAPQFPFTSSFPPAGPSMPSPIQHSASSPFQPVATRPQPFPARTE
HNGFPGEGQDSTPTSGNDNDAAVTGRQDREASQVMRQTSRDEHHEHGRENLLEREPLPRR
EDMRNVGEEPRDRRTSGPRDGAEGEQSIPPPMPAQPPPSQSHPHHHAHHRKPEERRESTP
TASLWAATDVPASVPSVILAPAAPPTLTQAPSVQPHPVPMFVPTPNLPNTMQAPPPAAAS
PPEKQQQQQPPASAIPSSSAFGTPSTVAATAPTTSASTPSQQSAASNDTYRNASAPPPDS
TTPGGQQQNIPPASTQSCSTPPSRQTSTVSNSSYSSQPSRPAEDRSQERRNPQESQPSPS
RSPRQVAGNEGEPEDRYSQRGQPQKPAGQATQPTDARRDMPLSTQSNQQPSSDGDYSRTR
DYRGREGDTAYSLHEPERPSSRSSNHGGDRDWDKDDKYYDRQDRRDSWYDQRDRRYDSRR
DYYQDRDYRSRSYEQDPRYARQGSYDSYYGRQESRERERPSSRQERERPSSRQGERPRSR
QDYDREAYYRQYSAEYDRSGYYDQEKYRRRRDYYGREYDSRSQRDPRYSRDYWANDPRYQ
EWYNYYYGRHGNSYDPRYYEYYKQHTQQQQQQQSQSQGYDMYAYDPRYDNTYDDEQYVDD
DRRSVHSNMSGHSSHSHHSQGWGGQYDDRFARDFHRDSTQSETSGYGHNNSAYGDWYRDS
SYQQGMSPAARTTPAKFHIPHMLARFGPGGHMIKVLPNNPADGMPAVVEVHGLETLLVNN
NEVEELRSFHGPLIKGVTHKSDVIRFCQDKAAACLASTDLRDKESAALLWQLLELLCRQN
GTIVGTDIAELLLQGHPSMAYPQRTETIVGTDIAELLLQGHPSMAYPQRTDTEERTIVGT
DIAELLLQGHPSMAYPQRTDTEDDDDDDDIDDRLSLNQCVLLSYRRSWVQTLQSCFSRAT
HPWRIPSTIVGTDIAELLLQGHPSMAYPQRTEAEGEDDDDDDDDIYDYTLFLNQCFSFPT
DDCGYRHCRAPAPGPPIHGVSPAYRGRGRGWGSQGDLSQASTASEGTVGGTEAADIERLT
QKFRELLLFGRKKDALEWAMKGGLWGHALLLASKMDSRAHANVMTRFANSLPMNDPLQTL
YQLMSHRQPAAVTSCADERWGDWRPHLAMVLSNHTQRPEVDRKSIITLGDTLGSRGLLHA
AHFCYLMAQANFGHYSKKASKMVLLGSSHSLPFMEFASNEAIQMTEVYEYAMTLGNAAHY
ILPSFQEYKFLYATRLAECGMTAQALTYCECIVSAVERAPTSFSSTLISQLHQLSERLFW
HDPQFSSLSTEEDQDYDWINSIRYMNQQVQEGALLPSSASDTPMFVGSTEPSIDGTSTPT
PGETTFTGVGTPQYDPNQQQELYEDPNNSYQPWSKPAPADMNLMASMNSEYSTTSATTTT
TDGGTEVENDVPDYYDQMAGQVSFKTLAPSSPDESPGDCPDDATEEDSESSPRMVQQQHR
GTPDSQGSQGRLRALSGSSHASTTRARSMSGSSQLSHGSQRMRRRQRTTSESSQVDIKEE
QSQKKQEKLSGGRKTKRVSVSPYQETPEQFTDLSKDSAKLEMAMPTGNSQQDQCQDVSSG
LDARGGGGFWREEASVRKKLFQLEVIQEQELEQTSPRCRKDLDKETDAEKDEAGRKVDQE
VPTASNLPSQSLKTAQSDLRVVEGQEETMLEKKEISDRKKVQESEVPNSRQASTKPMDSN
KASQSHQGQKSSTQRSGGTSWLGGLFTKMMRGKNEIHLPDDTNKSIVWDASRNKWVNQNE
DEEEDAAPPPPPPKDPMMPSPAGGPAPPPGNTPNRFSRRAGPTGKYVDVLNQSGTTKPAA
PPPDLFPGMAPGGNAMPNLFVPAAVPTSDANEPQGSQLQGTMTQGTPQGTHAPTQAQPMQ
PQDNAGPPPGDQGMAPPPQSMAAPPMFFNPSSFSSQSSPFNSPAQSVPRSLKKKAGKTLR
NLNPF
NT seq 7938 nt NT seq  +upstreamnt  +downstreamnt
atggcggaccaacctgctgacgacagtgcacagttccacggtggttatgcccaaccccag
cctgcacaagggtggcctccacaagactctgcacagaaacctgccttcttcaacccccag
cagatgccagcccctgccagtgggcctcccatgttcttcaaccctgccagcttcgacact
gccgccgtccctccattcctccctcagcaagggcctgcccaccccccgcagcagtgggat
cacccaacgtaccctccacagcaacagcaaccgacctggaattcccacgaggtccagaac
ggtccacctcaccaagggggttaccagggtggtaatgtacagcaaaacgagtacacccaa
cagcactactctaactggcaggaacaggacctgtacgcccctccagtctccgacccgctg
gctgacagtagagcgtcctcgtccttctatgagtcctccgggcagagctccaccctcggc
ttcaacttttccagtgaaaatccgtctttgaactctagcgagagaacctcgccgatgcta
gcagccggggactacggtcagggtggttatccgtacgacggaagcggaatggaaattccg
agagacgggatgcagcagccaccgtcagaaggagcggcaatgttccgacaaccggaggga
aattctgtcccgaacgattccgggcctgtaggacaatacttctccagtccagggaatacg
aatgcggcgccggtgccggcgagtatgccacaagtcagcatgttcaaccctcagtttggc
ctgccagaagagtcgagaagtgctgctagcctgggtcaggaagagggggcggaataccgt
ggggaggggacactaacacgagaactcacaggccaagaacaggagcagccagcggaaaac
gtccaacactttccaccacctcagaacaaccagcctccattgcatcatccaaacttggat
ggctcccaaactggccctgaaaacagcagctgggatttcggaggggcgcctcatcaggag
atgagaagagaactgacggggcaagaggacgggctagactcccagccacaagatcccgcg
cagtttgctttacagccgccagggccacaacaggcacctcccgtgttaactgtggaagag
ccagctgcaggggttccaacaccgagccctggggttccaacgacaagccccgggcactcc
cgtagcagttcccagcagtttgacgcgatcagtctggggagcgggaaggaagggaatgcc
tctcggagcggcagcagggctagttccctcatcgtagagggtcaggcgcagccgtcggtc
actccaggtggtggttccaccaacagtggcactagggaagactttgatgcaggtacaaga
ccggtgggtgaccacagcaggtcagggtccgtagactcgggcagaagcgttccgggaatt
gtagacggtccccctccccagagtgttgttggccaaccggagactgcgggaggcatggcg
aggagtcggtcggggtcggcagagtcggggaggagtgctcggagtaacaggagcacttcc
agcgtgccgccgccgccgccgctcaacgtgccgtaccaggagggcgccgcgatggagcgg
agtcggtccgggtccgcggagtcgggcaggagtggcagcagcggaaggccgccttcgctt
tcacgccacaaccgtgcagagtctaacgactctatccacagcgctgggagcaaccctgcc
ctgtcctcacagcctcccctgatggaggaacagagccctggcgacggagcgcccagcccc
cagccaacccagaccatcaggccctcggacgtcggtccgggagactccccagaaggtgcc
gcaagccccgacgagcccacacagccccagcaaggcgacggcgagcccgaacctccgcca
caaaacacccggcccccacaagcccgtcccagcggccacagcccccctcccccctcgcgg
ccaagcatacccaacttccccatcttctcccccatggagggctccatggcaccccagttt
cccttcaccagtagcttcccaccggccggacccagcatgccctcccccatacagcacagt
gccagcagccctttccaacctgtcgccacgaggcctcagccttttcccgctagaactgaa
cacaacggcttccctggggaagggcaggacagcacgccaacgtctggtaatgacaacgac
gctgcagtgacgggcagacaagacagggaagcatcacaggtcatgcgacagacgtccaga
gatgaacaccatgagcacggcagggagaacctgctggaaagagagcccctgccaaggaga
gaggacatgagaaatgtcggagaggagcctagagacaggaggacgtcaggaccgcgtgat
ggcgcagagggagagcagagcatcccaccgccgatgcccgcacagcctcctcccagccag
tctcacccacatcaccacgcgcaccatcgtaaaccggaggagcgtcgcgaatccacaccc
acggcatctctctgggcggcaacggacgtccccgctagcgttcccagcgtgatccttgca
cctgcggccccacccacgctaacccaggccccgtcggtccagccccatcccgtccccatg
ttcgtgcccactccaaacctccccaacaccatgcaagcccctccccctgctgcggccagc
cccccagagaagcaacaacaacagcagcctcctgcaagtgcgatcccctcttccagtgcc
ttcggtacacccagcacggttgctgccaccgccccgaccacgtctgcgtccacaccctcc
cagcagtctgctgcgtctaacgacacttacaggaacgcctccgcccctccccctgactca
acaacccctggtggtcagcagcaaaacataccgccggcatcgacccagagctgcagcacg
cctccttcgcgacagacaagcacggtgtccaactcctcctacagcagccagccaagcaga
cccgcagaggacagatcacaggaacgaaggaacccacaagaaagccagccatcgccttca
cgtagccccagacaagttgcaggcaacgagggtgagcctgaagaccggtatagccaacgc
ggacagcctcagaagcctgcagggcaggctacgcagccaacagacgcccgacgcgacatg
ccactgtctacgcagagtaaccaacagccgagctctgacggcgattattcgagaacaaga
gactacaggggaagagaaggggacactgcgtattctttacacgagccggagagaccgtct
agtcgctcgtctaaccacgggggtgacagggactgggacaaggatgacaagtactacgac
agacaggatagaagagattcctggtacgaccagagagatcggaggtacgacagcaggcgc
gactactaccaggatcgggactaccgaagcaggtcctacgaacaagacccgcgctatgcc
cgacagggatcgtacgacagctactacggaaggcaggagtcgagggaaagggagagacca
tcctccagacaagagagggagcggccaagttcgaggcagggagagagaccacgctcgcga
caagactacgatagggaagcttactaccgacagtacagtgctgaatacgacaggagcggt
tactacgatcaggaaaagtacagaagaagaagagactactatggaagagagtatgactcc
aggtcacaaagagatccaagatatagcagagactactgggcaaatgacccgcggtaccag
gagtggtacaactactactacggtcgccatggcaacagctacgacccgcggtactacgag
tactacaagcagcacacgcaacaacaacaacaacagcagtctcagtctcaggggtacgat
atgtacgcttacgaccctcgctacgataacacgtacgatgacgagcaatacgtggatgac
gaccggcgtagcgtgcacagcaacatgagcgggcacagctcccacagtcatcactcccag
ggctggggaggacagtacgatgataggtttgcgcgggacttccaccgtgactccacccag
tcggaaaccagcgggtacggacacaacaattctgcgtacggggactggtacagggactcc
tcctatcagcaaggaatgtcccctgctgccaggaccacgcccgctaagttccacatcccc
cacatgctggcacggttcgggccgggaggtcacatgatcaaggtgctgcccaacaacccg
gctgacggcatgcctgctgtggtcgaggtgcacgggctggagactcttcttgtgaacaac
aatgaagtggaggagctcagaagtttccatggaccgctcatcaagggtgtgacccacaag
agcgatgtgatcaggttctgccaggacaaggctgcagcatgcctggccagcacagacctg
agggacaaggagtcagccgcgctgctgtggcagcttctggagctgctctgtaggcagaat
gggacgatcgtgggtacagacattgcagagctgcttctccagggccacccatccatggcg
tatccccagcgtacggagacgatcgtgggtacagacattgcagagctgcttctgcagggc
cacccatccatggcgtatccccagcgtacggacacagaggagaggacgatcgtgggtaca
gacattgcagagctgcttctccagggccacccatccatggcgtatccccagcgtacggac
acagaggatgatgatgatgatgatgatattgatgatagattgtccctaaatcaatgtgtt
ctcctttcctacagacgatcgtgggtacagacattgcagagctgcttctccagggccacc
catccatggcgtatccccagcacgattgtgggtacagacattgcagagctgcttctccag
ggccacccgtccatggcgtatccccagcgtacagaggcagagggagaggatgatgatgat
gatgatgatgatatttatgattatacattgttcctaaatcaatgtttctcctttcctaca
gacgattgtgggtacagacattgcagagctcctgctccagggccacccatccatggcgta
tccccagcgtacagaggcagagggagaggatgggggagccagggggacctgtcccaggcc
tccaccgccagcgaaggcaccgtgggggggacggaggctgcggacatcgagaggctgacg
cagaagttccgggaactgctgctgtttgggaggaaaaaggatgccctagagtgggccatg
aaggggggtctgtggggccatgccctgctgctggccagcaagatggactccagagctcac
gccaacgtcatgacaaggtttgcgaacagcctgccgatgaacgaccctctacagacgctg
taccagctcatgtcccatcgccaacctgctgccgtcaccagctgtgcagatgagaggtgg
ggcgactggagaccacacctagcgatggtcctgtccaaccacacccagcgaccagaggta
gacaggaagagcatcatcacccttggggatacacttggttcccgaggtcttctccatgca
gcacacttctgttacctgatggcccaggccaactttgggcactacagcaagaaggccagc
aagatggtgctactggggtcaagtcacagcctccccttcatggagtttgcgagtaacgag
gccatccagatgacggaagtgtacgagtacgccatgactctgggcaacgctgcacactac
atcctgcccagcttccaggagtacaagtttctgtatgcaacaaggttagcagagtgtggc
atgacagcacaggccctgacgtactgtgagtgtatagtctcagcggtagagagagctccc
acatccttcagtagcacactgatctcccagctgcaccagctgtcggagaggctgttctgg
catgacccccagttctccagcctcagtacagaggaggatcaggactacgactggatcaac
agcatcagatacatgaaccagcaagtccaggagggcgccctgctgccatcctcagccagt
gacacgcccatgtttgtggggtccacggagcccagcatcgatggcaccagcacccccacc
cctggggaaaccaccttcacgggggtggggacgccccagtacgaccccaaccaacagcag
gagctgtatgaagatcccaacaactcgtaccagccgtggtccaagcctgcccccgctgac
atgaacctgatggcgtccatgaacagtgagtacagcaccacgtctgctaccaccaccacg
actgatggtggtacagaggtggagaatgatgtacctgactactacgaccagatggctgga
caagtgagcttcaaaactctcgcccccagtagtcctgacgagagcccaggagactgtccg
gatgatgccacagaggaggactcagaatctagccctcgaatggtacagcagcagcacaga
ggcacgcctgactcccagggttcccagggacgtctgcgcgccctcagcggcagttcccac
gcctccaccacgcgcgccaggtccatgagcgggtcgtcacagctgtcccacgggtcacag
aggatgagacgcagacagaggacaacctcagagtcatcacaggtggacattaaggaggaa
caaagccagaagaaacaggaaaagttgtcaggtggcagaaagaccaagcgtgtgagtgtg
agtccgtaccaggaaactcctgaacagttcacagatctgagcaaagactctgccaagcta
gaaatggccatgccaacaggcaacagtcaacaggaccagtgtcaggatgtcagcagtggg
ctggatgctaggggtggtggtggtttttggagagaggaagccagcgtcagaaagaaactg
tttcagttagaggtgatacaagaacaggagttggagcaaacttctccaagatgtaggaaa
gatttagacaaggaaacagatgcagaaaaggatgaagcaggaagaaaagttgaccaagaa
gtcccaacagcatcaaaccttccttcgcaaagtctgaaaactgcccaaagtgatctcaga
gttgtagaaggccaggaggaaacgatgcttgagaagaaagaaatttcagacaggaagaaa
gtgcaagagtcggaggtccccaactctaggcaggctagtaccaaaccaatggactcaaat
aaggcctcacaaagtcaccagggacaaaaatcctccacccagaggtcaggaggaacatca
tggctgggaggactctttactaaaatgatgaggggcaagaacgaaatccaccttccagat
gacaccaacaaatctattgtttgggatgcttcaaggaacaagtgggtaaaccagaacgag
gacgaagaggaggatgctgcgcccccacctccccctcctaaggaccccatgatgccgtct
cctgcaggtggacccgcacctccacctgggaacactcccaacaggttctccaggagggca
ggccccacaggaaagtacgtagatgtgctgaaccagagcggcaccaccaagcctgccgcc
cctccccccgacctgttccctgggatggctccgggagggaacgccatgcctaacctgttt
gtacccgctgctgtacccacgtcggatgccaacgaaccgcagggctcacagctccagggg
accatgacccagggcacccctcaggggacccacgcaccgacccaggcacaacccatgcag
cctcaagacaacgcaggcccccctccaggcgaccaggggatggccccacccccccagagc
atggccgcaccccccatgttcttcaacccctcctccttcagcagccagagctcccccttc
aactccccggcacagagtgttccgaggtcacttaagaagaaggccggcaagactcttcgt
aacttgaatccgttttaa

DBGET integrated database retrieval system