KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_68283Help
Entry
BRAFLDRAFT_68283  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bfo01001]
    BRAFLDRAFT_68283
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     BRAFLDRAFT_68283
Protein kinases [BR:bfo01001]
 Receptor tyrosine kinases (RTK)
  RET family
   BRAFLDRAFT_68283
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Ig_3 Cadherin ig Laminin_EGF Pkinase_fungal Ig_2 hEGF
Motif
Other DBs
NCBI-GeneID: 7228721
NCBI-ProteinID: XP_002613316
JGI: 68283
UniProt: C3XRK7
LinkDB All DBs
AA seq 897 aa AA seqDB search
MMLRVAFCTALLLLSGFQAYQDLFISGENVEIPEDVPVGSKVVRLRDFLDASVNSTDKRN
GTFWSVNITAGDGSGRFGVRAENLTLIVAAPMDYKLEPRYNLTVELTDNGNNNVLYVIIV
IVVMDVPGYPPFYNKRCETPVLLGREGDRVLGDYTVLSSDEGFYTYVNGEIIYSYAYDYL
QTDLPMTYPANLVLKGDCSGRFVGSTSALIDDLSPLIVVLQGQQGRAEFICRDRDGRNKG
NITVLDISLDDVDLPQWAQSRQFQTDEGDSFFFIFQLIEIWSTSSYWIRCGGNFRPPVAD
GAWLVEWAFHYNVTGCPVGSYGVYCDKDCVCQNGARCHGFNGACECRPGWRGRACDISWP
EVVIIASPGDLVVKYIGTNLTLTCLAPHINVANMTWAYQAGKRRDDTNVIEEGKARNSSI
SFQPILESANGRYSCMVQDEDGELFNATFILNATKCRPNYHGEDCSQVCDCEYGVTCDRW
EGCLCPPGRHGDRCEHTCAPGTFGWNCSMNCNCENNARCDPVNGSCICAEGQSGEFCQIV
SISGNNQVVVVVLASVIPTIAIIGCIVTGVLVKRRHRRSRSPEHPTMDLVLETFSSWEVE
KEDIRLEHMIGEGEFGHVVRGRLRVPEGYEVLVAAKSIRPDRMTASAVRDFRREMTTLTR
IHENKDGHPNVVKLYGVVTKSEPQYILVEYASNEELRRYLWSLREHLKTTGNSKLLERLG
FACDVASGLSELARLKIVHRDIAARNVVISDRKVAKIADFGLSRDVYVSSAYKRTNRGGE
EELLPLKWMALESLRDGVYTCESDVWSYGVLLWEIASFGEEPRYAGGPMHPDVCTLLELL
RKGVRLQQPENCPKSVYKIIRSCWIVDPLKRPTPDELFQKMDQMRPQRQAAILANRI
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atgatgctgcgtgtggcgttctgtactgcacttctgctgctgtctggcttccaggcttat
caagaccttttcatttcgggtgaaaacgtcgaaatacccgaggatgtgccagttggtagc
aaagtggtgcggctcagagattttcttgatgccagcgttaattccacagataaacgcaat
gggacgttttggtcggtaaacatcaccgcaggggacggttcgggacgttttggggttcgt
gcggagaacttgacgttgatcgtggcggctccgatggactacaagttagagccgcggtac
aacctgacggtggagctgactgataacggcaacaataacgttctgtacgtgatcattgtc
atcgtagtcatggacgtgccgggatacccgccattctataacaaacggtgtgaaacgcca
gtccttctgggcagagagggcgacagggtcctcggggattataccgtactcagcagtgat
gaggggttttatacgtatgttaacggagagattatttactcgtacgcttatgactatctt
cagaccgatttgccaatgacgtacccggctaatctcgtcttgaaaggtgattgttccgga
agattcgttggaagcacaagcgcacttatagacgacttgtctccactcatcgtggtgctt
caaggacaacaaggcagagccgaattcatatgtcgggaccgagatgggaggaacaagggg
aacattactgtattggacatttccctcgatgacgtcgacttgcctcaatgggcacaaagt
cgtcagttccaaacggacgaaggtgatagttttttctttatatttcagttgattgaaata
tggtccacatcatcatactggatacgatgtggcggtaacttcaggccccccgttgcggac
ggggcctggctggtggaatgggcatttcactacaacgtaacagggtgtcctgtgggatct
tacggtgtgtactgtgacaaggattgtgtttgtcagaacggtgcccgttgccatggcttt
aacggtgcgtgtgagtgccgtccgggctggagaggacgagcctgtgacatctcctggcct
gaggtcgtcatcatcgcgtcacctggcgatttagtcgtgaagtacatcggtaccaatctg
actttaacctgcctggccccacatatcaacgtagcaaatatgacatgggcttatcaagca
ggaaaaagacgtgatgacacaaatgtcattgaagaagggaaagcacggaacagttccatc
agctttcagccgattctagagtcagctaacggcaggtatagttgcatggtacaggacgaa
gatggtgaactgtttaatgcgactttcattctaaacgccacgaaatgccgacccaactat
catggggaagattgcagccaagtgtgtgactgtgagtacggagtgacgtgtgacaggtgg
gagggttgtctgtgtcctccgggccgtcatggagacaggtgtgagcacacatgcgcacct
ggcacattcgggtggaactgtagtatgaactgcaattgtgaaaacaacgccaggtgtgat
ccagtcaatggcagctgtatttgcgctgaaggacagtcgggtgagttttgtcagattgtt
tccatttctggtaataatcaagtcgtcgttgtagtgttggcgtccgttatcccgaccatt
gctataatcggctgtatcgtgactggagtcctggtaaaacgacgccaccgtcgctcaaga
agtccagaacacccaaccatggacttagtcttagaaacattttcatcatgggaagtagag
aaagaggacatccgtttagaacacatgatcggtgagggagagttcggccatgtcgtacgg
ggaagactgcgcgtgcccgaaggatacgaggttttggtggccgctaaaagtatccggcct
gaccgcatgacagcctctgctgtccgtgactttcgccgcgaaatgaccaccctcaccagg
atccacgagaacaaagatggtcacccgaatgtggtgaagctttatggggtcgtgactaag
tctgagccgcagtacatccttgtagagtacgcgagcaatgaagaactgaggcggtacctg
tggagtctgcgtgaacatctcaagaccacggggaatagcaaactgctggaacggctaggt
tttgcttgtgacgttgccagtgggttatcggagctggcacgtctgaagatcgtgcacagg
gacatcgcagctcgtaatgtcgtcatcagcgacaggaaggtggcaaagatcgctgatttc
gggctgtcgcgcgacgtttatgtttcctctgcgtacaaacgcaccaaccggggcggggag
gaggagctgttgccgctgaagtggatggccctggagtcgttacgggacggggtgtacacg
tgcgagagtgacgtgtggtcgtacggcgtgctgctgtgggagatcgccagctttggggag
gagccgcgctatgctggtggtccgatgcacccggacgtgtgcacactgttggagctgctg
aggaaaggagtccgtctgcagcagccggagaactgtcccaagtctgtgtacaagatcatc
aggtcctgctggatagtcgacccattgaagcgaccgacgcctgatgaactgtttcagaag
atggaccaaatgaggccacaaagacaagctgcgatcctggccaataggatttga

DBGET integrated database retrieval system