KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_68301Help
Entry
BRAFLDRAFT_68301  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     BRAFLDRAFT_68301
Peptidases [BR:bfo01002]
 Metallo Peptidases
  Family M2
   BRAFLDRAFT_68301
Exosome [BR:bfo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BRAFLDRAFT_68301
CD molecules [BR:bfo04090]
 Proteins
  BRAFLDRAFT_68301
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 7223572
NCBI-ProteinID: XP_002613334
JGI: 68301
UniProt: C3XRM5
LinkDB All DBs
AA seq 685 aa AA seqDB search
MARFILHLSIVVVVLFSVPTHCQKKNESEGVIFLEEYDTLAKELQNRAVIAGWNYQTNLT
DENAKKQVELNLEVAKFAKEAATNASEYDWENFSNVTVKRLFSMITTLGTAALEDEEKLE
QLNNLLSEMEEIYSTGQACEYDDPKTCLDLNPGLEDCMADSTDYNRLLFCWEGWRDAAGR
RLGDLYSQFVELSNEAVRADGWNDTGEYWRSWYETADLQQQLETIYQDLQPLYQNLHAYV
RRKLINTYGAEMVNAEGPIPAHLLGNMWAQTWGNIYNLVIPFPDKPSIDVTDEMVRQGYD
ALRMFNLSDEFFREMGQIPMPDSFWDRTMFVRPDDRDVVCHASAWDFYLDNDVRIKMCTK
VNQEDLVTVHHEMGHIEYFLQYAHQPLPFREGANPGFHEAVGDLLALSVSTPAHLNKVGL
LPELVDDPEVDINFLMQMALEKIAFLPFGYLIDQWRWRVFDGSTTKDKYNEEWWKLRTQY
QGIVPPVPRNPDKDFDAGSKYHVPANTPYIRYFVSFVIQFQFHEAMCTLSGYTGDLHKCD
ASAGAMKDVAGSRLAEMLRMGKSQPWPEAFEVLTGDREMSAAAILQYFAPLIDWLEKQNE
NETLGWNNGWTPPYDCEGTGGFTCLDGSRCVRPADKCDGIQDCDDNSDEDPILCETPNDD
SPRMTSSLVVVFLAVLASTVMTSRN
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgttttatcctgcacctgagcatcgtggttgtcgttctgttctccgtgccgacc
cactgtcagaagaagaacgaatccgagggagtgatatttttggaagagtacgacacactg
gcgaaggaactgcagaaccgtgccgttatcgctggatggaactaccagacgaacttgact
gacgaaaacgccaagaaacaggttgagctgaacttggaggtagcaaagtttgccaaagag
gcggccacgaatgcgtccgagtatgactgggagaacttcagcaatgtcacggtgaagcgg
ctgtttagtatgatcaccactctgggcacggccgctttggaggacgaggagaagcttgaa
cagttaaacaacctactatcggagatggaagagatctacagcacagggcaggcctgcgag
tatgacgaccccaaaacgtgcctggatctgaacccaggcctggaagactgcatggccgac
agtaccgactataacagactgctgttctgttgggagggctggcgtgacgcggccgggcgc
cgtctcggagatctctactcgcagttcgtggaactcagtaatgaggccgtgagagcagat
ggttggaatgacacaggagagtactggcgatcctggtacgagactgcagacttgcaacag
cagctggaaaccatctaccaggacctacagccgctgtaccagaacctgcacgcctacgtc
aggaggaaactcatcaacacgtacggagcggaaatggtgaacgccgaggggccaatcccg
gcccatctattgggtaacatgtgggcccagacgtggggaaacatctacaaccttgtcatt
ccgtttcccgacaagccaagtattgatgtaacggatgagatggtgagacagggttacgat
gctctgagaatgttcaacctgtcggacgagtttttccgtgagatgggccagatcccgatg
cctgacagcttctgggacaggaccatgttcgtccggcctgacgacagggacgtcgtctgt
cacgcctccgcatgggacttctacctggacaatgacgtcaggattaagatgtgcaccaag
gtgaaccaggaggacctggtgacggtccatcacgagatggggcatatagagtacttcctg
cagtacgcgcaccaaccgctgcccttccgtgagggcgctaatccagggttccatgaggcc
gtgggtgacctgttggctctgtccgtgtccacccccgcccatctcaacaaagtcggactc
cttccggagctggtggacgatcctgaggttgacatcaatttcctgatgcaaatggcgctg
gagaagatcgctttcctgccgttcggttacctgatcgaccaatggaggtggcgcgttttc
gacggaagcacaacgaaggacaagtacaatgaggagtggtggaaactgaggactcagtac
cagggtattgtacctcctgtaccgagaaatccagacaaggacttcgatgctggcagcaag
taccacgttcccgcaaatactccatacataagatactttgtgagtttcgtcatccagttc
cagttccacgaggctatgtgtactttgtcgggctatacaggagacctgcacaagtgcgac
gcgtccgccggggccatgaaggacgtagcaggcagcagactggctgaaatgttgaggatg
ggaaagagccaaccctggccagaggcgttcgaggttctgaccggagatcgtgagatgtcc
gcggccgccatattacagtacttcgctcctctgatagactggctggagaaacagaacgag
aacgagacactgggctggaataacggctggaccccaccgtacgactgtgagggaacaggt
ggcttcacgtgtctggacgggtccaggtgtgtccggcctgccgacaagtgtgacgggatc
caggactgtgacgacaactcagacgaggatccgatcctctgtgaaaccccgaacgatgat
tccccaagaatgacatcatcacttgttgtcgtcttcctggcagtcctcgcatcgacagtg
atgacgtcaaggaactag

DBGET integrated database retrieval system