KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_72819Help
Entry
BRAFLDRAFT_72819  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K14342  solute carrier family 10 (sodium/bile acid cotransporter), member 2
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bfo02000]
    BRAFLDRAFT_72819
Transporters [BR:bfo02000]
 Solute carrier family (SLC)
  SLC10: Sodium bile salt cotransporter
   BRAFLDRAFT_72819
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SBF SBF_like PDR_assoc
Motif
Other DBs
NCBI-GeneID: 7229403
NCBI-ProteinID: XP_002593108
JGI: 72819
UniProt: C3ZEG3
LinkDB All DBs
AA seq 376 aa AA seqDB search
MESFTKTAADEAPGSSTAFSLPPVFTDSRAWATNTTGNNTASLPEENGGIPGIVMDVVVT
FTVCLILVAMGCTLDLQAMLKYIKRPYGIGVGVMSQFVIMPLVAFLLCLAFQSQLDPARA
LSILVVGTCPGGHMSNLLVYWLDGDMNLSICMTTVSTALAMGLMPLCLWIYSKPFISAST
VVVPYEKIVIALVTIIIPVSAGMFLKYKSPKWARRFLKIGGIFGIVIILSSAVLGGIAYQ
DMWTGPPALFLIAFIFPTIGYSFGYVIAWLFRMDATCRKTVCIETGTQNIGIALSILKLT
FAPELASKIILFPMLYASFQGLEAMILVISFQIWKRKCKTVKEKEEKEVGDDTKDVNLLD
DHKTTDEDMYEFVTTL
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggaatcttttaccaagacggctgcggacgaagcaccgggaagttctacagcgttctct
ctgcctccagtatttacagacagtcgggcttgggctacgaacactaccggtaacaacaca
gcctcgcttccagaggaaaatggcgggatccccggcatagtgatggacgtggtggtcacg
tttaccgtctgtctgatcctagttgccatggggtgcactctggatttgcaggccatgctg
aagtatatcaagaggccgtacgggataggggtgggagtcatgtcgcagttcgtcatcatg
ccgctagtggcgttcttgttgtgccttgcctttcagtcccagttggatcctgcacgcgcc
ctgtccatcctggtggtcggaacctgcccgggcggccacatgtccaacctgctggtgtac
tggctggacggagacatgaatctcagtatttgtatgacgactgtgtccaccgccctggct
atggggctgatgccgctgtgcctgtggatctacagtaaacccttcatatcggcctcgacc
gtcgtcgtaccttacgagaagatcgtcatcgctctggtcaccatcatcattcctgtcagc
gcgggcatgtttctcaagtacaagtcaccgaaatgggccaggcggtttctcaagattggc
ggcatattcggcatcgtcatcatcctatccagcgcggtgcttggtgggatagcctaccag
gacatgtggaccggtcctcccgccctttttctcatcgccttcatcttccccacgattggc
tactcctttggttacgtcatcgcctggctcttccgcatggacgccacctgccgcaaaacg
gtgtgcatcgagacggggacccagaacatcggcatcgccttgtctattctaaagttgaca
tttgctccggaactagcaagtaagatcatcctcttccccatgctatacgccagttttcag
ggtctagaggccatgatactggtaatctccttccagatctggaaaagaaagtgcaaaacg
gtcaaggagaaggaagagaaagaggtgggagatgataccaaggatgttaacctacttgac
gatcataagactacagacgaagatatgtacgaattcgttactactctgtaa

DBGET integrated database retrieval system