KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_84623Help
Entry
BRAFLDRAFT_84623  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K04294  lysophosphatidic acid receptor 3
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    BRAFLDRAFT_84623
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bfo04030]
    BRAFLDRAFT_84623
G protein-coupled receptors [BR:bfo04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    BRAFLDRAFT_84623
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srv 7TM_GPCR_Srx ATP-synt_I NICE-3
Motif
Other DBs
NCBI-GeneID: 7234528
NCBI-ProteinID: XP_002592197
JGI: 84623
UniProt: C3ZH61
LinkDB All DBs
AA seq 376 aa AA seqDB search
MNESTANFTGGNSTVFETFWPCFRGQLENNVDYDLSVASCSHLPAPNLDENRKVGIIAAT
VGTVALLMNGAVLAGGLKNRHLSKPMHLFVANLATADCAAGFFSFFFCAIFQKEVPQPLT
SVRVVCTFLLVLVLSAVSVVLLSVDRYLAILHPIFYQTRMSKRHVAVSLAITWPVCVLVY
LSPLMGWNCIDSDMNTENCIAQLPVGYLILVNIILFMAVVIVIFTNDRIFIVLKRRISRT
RPMATESPQDNLPAARRREQRLAARKFQHLLHSLKKQVTVVIIAAVFVVSWLPLCIDMVR
QFLCFAREDCEMEAKPKWGMLIGLCSSVINPVIYALRIEKIRDAMQRRARRLANAVREKF
GWSSNQVVNIQVVGAP
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaagcaccgcgaacttcaccggaggaaactccacggtgttcgagactttctgg
ccttgcttccgcgggcagctagaaaacaacgttgactacgacctgtcggtagcttcctgc
tctcatctgccagctccgaatctggacgagaaccggaaagtcgggatcatcgccgccacc
gtcgggacagtcgctctcctcatgaacggcgcggtcctggccggggggctgaaaaaccgc
cacctgtccaaacccatgcacctgttcgtggcaaacctggccacggcggactgcgcggca
ggtttcttctcgttcttcttctgtgccattttccagaaggaagtgcctcaaccactgaca
tcagtgcgcgtagtctgtaccttccttttagtgctggtcttatcagcagttagcgtggtc
cttctatccgtggaccgttatctggccatcctccacccgatattctaccagacccgcatg
tccaagcgacacgttgccgtgagcttggcgatcacatggccagtttgtgtgcttgtctac
ctgtctcccctcatgggctggaactgcatcgatagtgatatgaacacagagaactgcata
gcacagctgccagtgggctacctgatcctggtcaacatcatcttgttcatggccgtagtg
atagtgatcttcaccaacgacagaatcttcatcgtactgaagcggcgcatctccagaacc
agacccatggctaccgagagccctcaagataacctacccgccgcaagacgcagggaacaa
cgactcgccgcaagaaaattccagcacctcctacacagcctgaagaagcaggtgacagtt
gtcattattgcagcggtgttcgtcgtcagctggctgccgctctgcatcgacatggtgcgg
cagtttttgtgctttgcaagggaagactgtgagatggaggcaaagccaaaatgggggatg
ttgatcggtctctgcagttcggtgatcaacccggtcatctacgcactcaggatcgagaag
attcgagacgctatgcagcgcagggcccgacgactcgccaacgcggtgcgtgaaaagttt
ggctggtcatcgaatcaagtggtgaacattcaggttgtcggagcgccgtga

DBGET integrated database retrieval system