KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_85223Help
Entry
BRAFLDRAFT_85223  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00052  Galactose metabolism
bfo00500  Starch and sucrose metabolism
bfo01100  Metabolic pathways
bfo04142  Lysosome
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BRAFLDRAFT_85223
   00500 Starch and sucrose metabolism
    BRAFLDRAFT_85223
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    BRAFLDRAFT_85223
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bfo04147]
    BRAFLDRAFT_85223
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     BRAFLDRAFT_85223
Exosome [BR:bfo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BRAFLDRAFT_85223
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil
Motif
Other DBs
NCBI-GeneID: 7241911
NCBI-ProteinID: XP_002605077
JGI: 85223
UniProt: C3YF85
LinkDB All DBs
AA seq 803 aa AA seqDB search
MAESYPLSAWNTPDKKVPLEELLEDSSSSSSSAASVRNVQLQGVPPQHVTVHLKPVEERG
PDYRYPEFVNYALEEPFLLKSEVEKCEKFPHLKDEADQQHRDCTVEKCEKFPQLKDEADQ
QHRDCTVPYLPLYLYLPVSSPVAGGEVEKCEKFPHLKDEADQQHRDCTVEKCEKFPHLKD
EADQQHRDAFFSLQAKIEARQLDEMKRESFRRYVGVSTWRGQCTCKVCMVYLMAFFMLLL
MGVCAVGMIFNIVMGNNLFIPVMPMVKRPSQPKVGPSAPGQGPPGYAPQCPDEDNDHRFD
CYPEAIASQAKCEGRGCCWRKPNGVPFCFFPPGFPSYSLGEVKDTPLGATAVLTRDNASS
PYPKDVNQLTMDLRFETNGRLHLVLNDTSSKRFEVPIETPTATTKAASPLYEVEYSHDPF
GIVVKRRSNGRVLLNTTVAPLIYADQFLELSTTLPSRNIYGLGEHRGPFRHSLDWVRIPF
WARDKPSAEAKEDVTNLYGSHPFYLCVEEDGQAHGVFLLNSNAMVPVGYVGGNVICDAFY
LIERKGVEEVRDFSVVELIQEVSVAGLGKQNRKPYSNSLVTALFLERPKEVILQPAPALT
WRTIGGILDFHIFLGPDPDSVIRQYWEVIGTYHNSVIRQYWEVIGYPMMPPYWALGFHLC
RWGYGSANRTMDIVQKMRNAGIPQDTQWNDIDYMTRHLDWTYDEDKFAELPEVVKDLHDH
GQHYIMIVDPGISNTQKAGTYPPYDVGLKRGVFINDTNGNPIVGSVWPGDTTFPDFTNPI
TQQWWQEMAADFHKKVPFDGMWI
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atggcggagagttaccccctatcggcgtggaacacgcccgacaagaaggttccgttagag
gagcttctcgaggattcctcctcatcttcctcctctgcagcctccgtccggaatgtgcag
ctccaaggtgtgccaccgcagcacgtaactgttcacctgaaacctgtggaggagcgaggg
ccggactaccggtacccggagttcgtgaactacgccctggaggagcctttcctcctcaag
tcagaggtggagaagtgcgagaagttcccccaccttaaggacgaggccgaccagcagcac
agagactgtactgtggagaagtgcgagaagttcccccagcttaaggatgaggctgaccag
cagcacagagactgtactgtaccttacttaccgctgtacctttacttacctgtctcctca
cctgtggcaggtggagaagtggagaagtgtgagaagttcccccacctgaaggacgaggcc
gaccagcagcacagagactgtactgtggagaagtgtgagaagttcccccaccttaaggac
gaggcagaccagcagcacagagacgccttcttctcactccaggctaagatcgaggccaga
cagctggatgagatgaagagggagtccttcaggcgctacgtgggggtgtctacctggcgg
ggacagtgcacctgtaaggtgtgcatggtttacctgatggcgttcttcatgctgctgctg
atgggagtgtgcgctgtcgggatgatcttcaacatcgtcatgggtaataacctcttcatc
cccgtcatgcccatggtcaaacgaccttctcagcctaaagttgggcccagcgcccccggc
caaggccccccaggttacgccccgcagtgccctgatgaggacaacgaccacaggtttgac
tgttacccagaagccatcgcttcgcaggccaaatgtgagggtagggggtgctgttggcgg
aaacccaacggtgtgccattctgcttcttcccgcctggctttccctcctacagcctaggg
gaggtgaaggacaccccgcttggcgccacagcagttctcaccagggataatgcctccagc
ccctaccctaaagatgtaaaccagctcaccatggacctcaggtttgagaccaatggcaga
ctgcacttagtgttgaacgacacgtctagcaagcgattcgaggttcccatagagacgccc
acggcaaccaccaaggccgcctccccgctgtacgaggtggaatactcccatgatcctttt
ggcatcgtggtgaagcgacgcagcaatggccgcgtgctgttgaacacgactgttgccccg
ctgatctacgctgaccagttcctggagctctccaccacgctgccgtcccggaacatctac
ggtctgggcgagcaccgcgggccgttccgacacagcctggactgggtccgcatccccttc
tgggcgcgggacaagccttcggcagaggccaaggaagatgtgaccaacctgtacggctcc
cacccgttctacctgtgtgtggaggaggacggacaggcgcacggggtcttcctgctcaac
agcaatgctatggttcccgttggctacgtcggcggcaatgtcatctgcgatgctttctat
ctcattgagaggaagggcgtcgaagaagtcagagatttctccgttgtcgagctgatccaa
gaggtttccgttgcgggcctggggaagcaaaatagaaaaccttactctaactcattggtt
actgcgctgtttttagagcgcccaaaagaggtgattctgcagcctgccccggcgctgacc
tggcgaaccatcgggggcatcctggacttccacatcttcctgggcccggaccctgactct
gtcatacggcagtactgggaggttataggtacgtaccacaactctgtcatacggcagtac
tgggaggttataggttaccccatgatgcccccgtactgggccctagggttccacctgtgc
cgctgggggtacggctccgccaacaggaccatggacattgtgcagaagatgaggaatgca
ggcattccgcaggatacgcagtggaatgacattgactacatgactcgtcacctggactgg
acgtatgacgaggacaagtttgcggagctgcctgaagttgtgaaggaccttcacgatcac
ggccagcactacatcatgatcgtggacccaggcatcagtaacacacagaaggcaggcacg
taccctccctacgatgtcgggctgaagaggggagtgttcattaatgataccaacgggaac
cccattgtgggaagcgtctggccaggagataccacgttcccggacttcaccaatcccatc
acccaacagtggtggcaggagatggcagcagacttccacaagaaagttccctttgacggg
atgtggatc

DBGET integrated database retrieval system