KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_88359Help
Entry
BRAFLDRAFT_88359  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    BRAFLDRAFT_88359
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bfo01002]
    BRAFLDRAFT_88359
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bfo04147]
    BRAFLDRAFT_88359
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     BRAFLDRAFT_88359
Peptidases [BR:bfo01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   BRAFLDRAFT_88359
Exosome [BR:bfo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BRAFLDRAFT_88359
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986
Motif
Other DBs
NCBI-GeneID: 7247498
NCBI-ProteinID: XP_002589500
JGI: 88359
UniProt: C3ZPL4
LinkDB All DBs
AA seq 242 aa AA seqDB search
MHFFVLLALVSYAAAEGYEDRIIGGFEATPGSVPWQVSLQRSGSHFCGGTLLNSQWVLSA
AHCLVSGMTVVAGEHDLSRNDGHEQSRGVERIIPHPNYNDNTLDNDIMLIKLSSPVTISS
WVSPASLPDSMVSAGTNVIVTGWGNTGSNYPDKLQKVRVPVISRATCNGANAYAGAVTTN
MFCAGYMDGGKDSCQGDSGGPVTRSGTVYGVVSWGYGCAQPNYPGVYTKVKKYTSWINVY
IN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgcacttcttcgttcttcttgctcttgtctcttacgctgcggcggagggatacgaagac
cggattattggcggtttcgaggcgaccccgggtagcgtcccgtggcaggtgtccctacag
cggtccggcagccatttctgtggcggcacgctcctcaacagtcaatgggtcctcagcgcc
gctcactgcctagtcagtggcatgactgtggttgctggagagcacgacttgagcagaaac
gatgggcacgaacagtcgcgtggcgtagaacggatcataccacatccaaactacaacgac
aacacgctggataacgacatcatgctcatcaagctcagctctcccgtcacgatcagctct
tgggtcagccccgcgtctctgcctgactccatggtttcggccgggaccaatgtcatcgtc
acgggctgggggaacactggatctaactacccggacaagctgcaaaaggtccgagtgccc
gtcatctcccgcgccacctgtaacggcgctaacgcttacgccggcgcagtaaccaccaac
atgttctgtgcaggctacatggacggcggcaaggactcctgccagggagacagcggcggc
cccgtgacgaggtccggtactgtgtacggcgtggtgagttggggttacggctgtgcccag
cccaactacccgggagtctacaccaaggtgaagaaatacaccagctggatcaacgtctac
atcaattaa

DBGET integrated database retrieval system