KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_88587Help
Entry
BRAFLDRAFT_88587  CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo03440  Homologous recombination
bfo04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:bfo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    BRAFLDRAFT_88587
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    BRAFLDRAFT_88587
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bfo01001]
    BRAFLDRAFT_88587
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bfo03032]
    BRAFLDRAFT_88587
   03400 DNA repair and recombination proteins [BR:bfo03400]
    BRAFLDRAFT_88587
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BRAFLDRAFT_88587
Protein kinases [BR:bfo01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   BRAFLDRAFT_88587
DNA replication proteins [BR:bfo03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     BRAFLDRAFT_88587
DNA repair and recombination proteins [BR:bfo03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    BRAFLDRAFT_88587
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAT TAN
Motif
Other DBs
NCBI-GeneID: 7246274
NCBI-ProteinID: XP_002604298
JGI: 88587
UniProt: C3YH73
LinkDB All DBs
AA seq 2357 aa AA seqDB search
MTDLLTHDLRDCCCHLESDKVTERKKNAEKLRSLLSKPALVALLDKNSDSRKSGRGLTWD
GIFKVIRGHIQKFDRTLLARTLHTLMQGASVQCNIRGKNLFRFFTEYMKNARQEKNLAVL
EPLVSAMNVFCKTMSADCRGQICKLGEATALGLLYVWNNRPPAQLKEEIIEFFRIQMCAH
HPMGAMSEQQGEYSHDQDVWKSHLKKLYDAIYNDLEHVGGRSRFTSVTKDSALSPGFVDL
AADVFHQLFLDQQPAIEVTQMTLSTQKVGRGPPVKRRRLEVGWSMVVDILKEMRGPGLVP
WLQVLTSLLQKYPRSVPADQLVPLLAALNNAQVECKKGDVSSHILSCLEALVPSHQYHRG
EDEDLAQVCGPLWSSVWTCTMKAVSLHHAEDQAFSLLGCLVQEKLVQPDREVWRLLCAST
PSKAAVEFLAVFLSCQPLPESFTPANLPMERPSDNAPYPLRHELLQWLLPTEDAEDVDGM
TSNIQKHFTRKSPTKDSLSQQLQDMATLYLKSSFVLPLQETPPQGCKMVEPVASCSSLPS
VLESLLAHLTRTSRQLQKVTDVKPTDTEKLVEHCTLLMKVMCFLVDRGVWKPQDVAGSTL
YQDTKTALKQVTTQLSEFLKKEGEGPQAVIDSLHQLFLWDTAKESREVGQLRRAMLRAVV
PSRLIDLLIDMALGKISFVRSCSSSSARPSITTTFDEDSDDFDEFDNFDSSHGNGKSRVM
GSFEDFDDSPPSQQEPQSNGESTSTDLGNSGDMNLGGAADPDLIKEKLIQEFCNEFLQVV
ETLCGPDVPLYDEDVKKLIQTISDWSTLTLRDDRRNDVPYPLSQLFPQLLRDKSHRIRIR
MAIACLQLFQTVHVKTSGDRCLRPADRGDQEKVFASIYEALQETMTVPGKLSADEIEDES
ANRVASMLATLAAVACSSAACEKRALFALFQVTRRPTQGGDDLTPDLETGEEQMEQDGNS
LSNVAPELTIKVLQQIARYFGHPTCGAYLSEHLGYLVHQWVQEGYRVIDLQYTLMGYTCR
RDFYRDQYSTIVPHLVMQKDMQTVRHIAEELECDWVALLHSCFPRIIVNVLPLFAEQGPE
EQSDRSLERVQQARECLDLIEKSIGGDSVNKLSQKHLDDIVIELLMTFHEVSKDDPDVNQ
FIKASDPEPNPPCFTSYTIRATMDYLTSCHASRQKTAIVLLAKSQPDSLQRILLALSTRM
TKTQSIHEKRRVLGMYQLFTALLLSDLENLGGVWVFILRDVIYTLVHRLQEARRLAGSGK
TEDGMELFSLSCDILYTVCQEALRCCAESIVRHLSVIVGALIPYVESPLDKGRQAVSLIN
FLIIDNEETLHEAISILDPLPECRSLKRAREVLHRARLQGGVVGLKEEIHHFLRAVQLSP
GGGSVESFWSLRARLTKEKDQLAAISRGQQRGETDILSQLVCTLINFCFQTSSQDVSSSQ
DAAQNVLQEEVGLCLGEIGAVDLTAIALKHGAQKTSAAKAMQVFRHDSTMQRTCVIMHLL
DEYLLDEDVDVVAAAGQCLKMILSTAAAGTEWYRHYKEGLKEEGTLLCYLQPFKLQKRKL
PLPPVKTCTDSEFTSVFGRASLWIPEPGCHGNWITELVCSLIDSGAIQDEVLRLLTPVCK
VKVDFCEQLLPFLVHSILLQGRDSVRQLLSMQLSTFFSRHCQTAETASRSATPLPTQASQ
VLPTKPALDQASVNTMLRVVHYLRQQERPARDSRKATPWHNNFWLDLDYLEVSKAAQTCG
AYFTSLLYMEIYCEQRNNQNNIICKTTSRAEEDSQGSQRSQASQGSQDSQGTALSSLSTL
SANSSLTLQSLLMEAYCHIGEPDGVYGCGAGRLTDTSARIVTYEHEGKWDKALGAYDLQM
SSPTAVIQAGVLDALKNFGCGHVLNMSECVADSPELREAQYQAAWRNGIWDLDVDAGVDA
MPGFHQGLYTGVCAVKDRDSTLFETTVKQTRLSVVGRLASTGLESARSVYPHLVRLRCLI
ELQDFKTLVTDSTSCDDARQLVQKWEAQTPLLQNDFDFVEPVLALRSTLLQLAGGAGGGE
RGAVLREALVTHLEMLARCARKAARFQVAERAIHTLKQLERSESTTWSWQLEEAKLYWCR
GEQGAAIHILKALISKLEVEQISDDNCTATELFPQALGLNGHWLAVTQTESPYNICEDYL
AKAADLMSRMEQQTPAALEAYLALARFTDQQYQVIVNYMKSSTYEAKKDMIERSKAEVEK
MTQSGVVANRYFKIMKRHMVDGKDELEGLNEDRDAFLHKAMENYIRCLKAGDEHDLRVFR
LCSLWFRNAHNPDINQLAKENFPKLESRKFLPLIYQLAARMGTKSQGSPDFQSTLLQVDS
MLLVISTNFSTLTTSYT
NT seq 7074 nt NT seq  +upstreamnt  +downstreamnt
atgactgacctcctgacccatgatctgagggactgctgctgtcatctggagtcagacaag
gtcacggaaaggaagaaaaatgctgagaagctgcggtcgctcctgtccaagcctgcgctg
gtcgctctgctggacaagaactcagacagcaggaagagtgggcgtggcctgacctgggat
ggcatcttcaaggtcattcggggtcacatccagaagtttgatcgcacactcctggctcgt
accctgcacacactgatgcagggggcctccgtgcagtgtaacatcaggggcaaaaacctg
ttcagattcttcactgagtacatgaagaatgccagacaagagaagaacctggcagttctg
gagcctcttgtttctgccatgaacgtgttttgtaagacgatgtctgcagactgcaggggt
cagatctgtaagctgggggaagccaccgccctgggactgctgtatgtgtggaacaacagg
ccgccagcgcaactcaaggaggagattatagagtttttcagaatacaaatgtgcgcacac
caccccatgggggccatgtcagaacagcagggagaatactcacacgaccaagacgtctgg
aagagccacttgaagaaactgtacgacgccatctacaacgaccttgagcatgttggaggt
cgcagccggttcacctctgtaaccaaagactcggccctcagccctgggttcgtggacctg
gcagcagatgtgtttcaccagctatttttggaccagcagccagcaatagaggtgacccag
atgaccttgagtactcagaaggtcgggcggggtcccccggtcaagaggcgtcgacttgag
gtgggctggtccatggtggtggacattctcaaggagatgaggggaccaggactcgtccca
tggctacaggtgttaaccagtctgctccagaagtatcccagaagtgtccctgctgaccag
ttggtgccactgctggctgcactcaacaatgcacaggtggagtgtaagaaaggtgatgtc
tcctcccacatcctgtcctgtctggaggccctggttcccagccaccagtaccacagaggt
gaggatgaggacctggcccaggtgtgtggccccctgtggagctcggtgtggacctgtacc
atgaaggctgtgagcctgcaccatgcggaggaccaggccttctccctgctggggtgtctg
gtgcaggagaagctggtccagccggacagggaggtctggagactgctgtgtgcttcaaca
ccatccaaggcagcagtagaattcctggctgttttcctcagctgccagccccttcctgag
agcttcacacctgccaacctgcccatggagcgaccaagcgacaacgccccctatccactc
cgacatgaactgctccagtggctcttaccaactgaagatgcagaggatgtggatggaatg
accagcaacattcaaaaacatttcaccaggaaatcaccgaccaaagacagcctgagtcag
cagctacaagacatggccaccctctacctgaaatcctccttcgtccttcccctccaagaa
acacccccacagggatgcaagatggttgaacccgtggccagctgcagctccttaccgtca
gtgctggagtctctgttggcacatctcactagaacgtccagacagctccagaaggtgaca
gatgtcaagcccacagatacagagaagctggtagaacactgcaccttgttgatgaaggtg
atgtgtttcctggtggacaggggagtgtggaaaccacaggatgttgctgggtctactcta
taccaagacacaaaaactgccctgaagcaagtcaccacccagctgtcagagttcctgaag
aaggagggggaggggccacaggctgtgattgacagcttgcaccaactgtttctctgggat
acagcaaaggaatcgagagaagttggccagctgcgcagagccatgctgagagctgtggtg
cccagcaggctcatagacctgctcattgacatggccttaggcaagatctcatttgttaga
agctgcagttcatcatctgctcggccgtcaattaccacaacttttgatgaggattctgac
gactttgatgagtttgacaacttcgacagttcccatggaaacggcaaaagtcgagtaatg
ggcagctttgaagattttgatgactccccaccaagtcaacaggagccgcagagcaatgga
gaatcaacttcaacagatctggggaattctggggacatgaacttgggcggggctgctgac
cctgacctcatcaaggaaaaactcatccaggagttctgcaatgagtttctccaagttgtc
gagactctgtgtggaccagacgtgcctctgtatgacgaagatgtgaaaaagctgatacaa
accatcagtgattggtccaccctgaccctgcgcgatgaccggaggaatgacgtgccgtac
ccgctgagccagctgtttccgcagctgctgagggacaagagtcaccgcatccgcatcagg
atggcgatagcatgcttacaactgttccagactgtgcatgtgaagaccagcggagacagg
tgtctgaggcctgcagacagaggcgaccaggagaaggtttttgcctccatctacgaagct
ctgcaggaaaccatgactgttcctgggaagctctcagctgatgagatcgaagacgagagt
gccaacagagttgccagcatgttggccaccctggctgctgtagcctgcagttccgccgcc
tgtgagaagagggcgctgtttgccctgttccaggtcaccaggaggcccacccaggggggt
gatgatttgacccctgacctggagacaggggaggaacaaatggagcaggatgggaattct
ctgtctaacgttgctccagaacttaccatcaaggtactacagcagatagccaggtacttc
ggccaccccacctgtggagcttacctgtctgaacacctgggctatctggtgcaccagtgg
gtacaggagggttacagggtcatagacctacagtacacactgatggggtacacttgcagg
agggatttctacagggaccagtacagcaccattgtcccccacctggtcatgcagaaggac
atgcagactgtgagacacatcgcagaggagctggagtgtgattgggtggccctgctccac
tcatgcttccctcgcatcatcgtcaacgtgctcccgctgttcgccgagcagggccctgag
gaacagtccgacaggagcctggagcgcgtacagcaagctcgagaatgcctcgacctcatc
gagaaatccataggaggggacagtgttaacaaacttagccagaaacacctggacgacatc
gtcatcgaactgctgatgacgttccatgaggtctccaaagatgatccagacgtcaaccag
ttcatcaaagcgtcggacccggagcctaaccctccctgcttcacctcttacaccatccgt
gccaccatggactatctcaccagctgccacgccagtcggcagaagacggcaatcgtcctg
ttggccaagtcccagcccgatagcttacagagaatactgctcgctctctcaacaaggatg
acaaagacacagagcattcatgagaagcgtagggttctggggatgtaccagctctttact
gctctgctgttgtcggacctggagaacctggggggagtctgggtgtttatcctgagggac
gtcatctatacactggtgcacaggctgcaggaggcacgcaggctggcagggagtgggaag
acagaagatggtatggagttgttctccctgtcctgtgacatcctgtacacggtgtgccag
gaggccctaaggtgctgcgctgagtccatcgtccggcatctctccgtgattgttggtgcc
ctgattccttatgtggagagtccactagacaaggggaggcaggccgtcagcctcatcaac
tttcttatcatcgataatgaagagactctccatgaggcaatcagcattctggaccctctg
ccggagtgtcgatcattgaagagggcaagggaggtgctgcaccgcgccaggctgcaaggg
ggcgttgttggccttaaagaggagatccaccacttcctgcgagcggtccaactctcgcca
ggaggcggcagtgtggagagcttctggagcctgagagccaggctaaccaaggagaaagac
cagctcgcagccatctcacgaggccagcaacgcggggagacggacatcctgagtcagctg
gtctgtactctcatcaacttctgcttccagacttcgtcgcaagatgtctcgtcgtctcaa
gacgctgcacagaacgtcttgcaggaagaggtcggcttgtgtctgggagagatcggggca
gtggacctgactgctatagccttgaagcatggagcacagaagacgtctgcagccaaggct
atgcaggtgttccgccatgacagcaccatgcagaggacctgtgtgatcatgcacctcctg
gatgagtacctgttagatgaagatgtggatgttgtagcagcagcagggcaatgtctgaag
atgatcctgtcaacagctgcagcaggtacggagtggtacagacattacaaagaaggactg
aaggaagaaggaaccctcctgtgctacctgcagcctttcaagttacagaaaagaaagctg
cctctcccaccagtgaagacctgcactgattcagagttcacctcagtgtttgggagagcc
tctctttggattcctgagccaggttgccatggcaactggatcacagagttggtgtgcagt
ttgattgacagcggagccattcaggatgaagtccttcgtctgcttacacctgtctgcaag
gtgaaggtggatttctgtgaacagctgcttccgttcctggtgcacagcatcctgctgcag
ggcagggacagtgtgagacagctgctgtccatgcagctgtcaaccttcttctccaggcac
tgccagacagctgagacagccagccgctctgcaacacccctccctacacaagcttcgcag
gttcttcccacgaaaccggcactagaccaagcgtcagtgaacaccatgctgcgtgtggtc
cactacctcaggcagcaggagaggcctgcaagggacagccgcaaagccacgccctggcac
aacaacttctggttggaccttgactacctggaggtgtccaaggctgcccagacctgcggg
gcatacttcacatcactactgtacatggagatctactgtgaacaaagaaacaatcaaaac
aatattatttgtaaaactacatccagggcagaagaagactcccaaggctcccagaggtcg
caggcctcccagggttcccaggacagccagggtactgccctgtccagcctcagcaccttg
tctgccaactccagcctcactttacagtcacttctaatggaggcctactgccacatcggt
gagcctgacggcgtgtacggctgcggcgccgggcgtctcactgacacgtctgcacgaatc
gtcacgtacgagcacgaagggaagtgggacaaggctctcggagcttacgacctccagatg
tcttccccgaccgcagtcatacaagctggtgtactggacgcactgaagaactttggctgc
ggccatgttctcaacatgtcagaatgtgttgcagacagcccggagctgagagaggcccag
tatcaggctgcatggaggaacggcatttgggacttagacgtcgacgcaggcgtggacgcc
atgcctggcttccaccagggcctgtacacgggcgtgtgtgcagtgaaggatcgggacagc
acgttgtttgagaccacagtgaagcagactagattgagcgtggttggaaggctggccagt
acgggcctggaaagtgctcgaagcgtttatccccatctggtcagactcaggtgcttgatt
gaactacaggacttcaagacattagtgacagactctacgtcctgtgacgatgccagacag
cttgtgcagaagtgggaagcacagacccccctcctgcagaacgacttcgacttcgtggag
cctgtcctggccctgaggagcaccctgctacagctggctgggggggctgggggtggggag
aggggggccgtactgcgggaggctctggtcacacacctggagatgttggccaggtgtgcc
aggaaggctgccaggttccaggtagcagagagggccatccacacccttaaacagttggaa
cggtccgaaagcaccacttggtcctggcagcttgaagaggccaagttgtactggtgtagg
ggggagcagggtgccgccatccacattctgaaggccctgatcagcaaactggaggtggaa
cagatctcagacgacaactgcacggcaaccgagttgttcccacaagccttagggttgaac
gggcactggctggctgtgacacagacggaaagtccgtacaacatttgtgaggactacctt
gcaaaggctgcagacttgatgtctagaatggagcagcagacgccagcggcgctggaagcc
tacctggctctcgcccgcttcacagaccaacagtaccaggttatcgtcaactacatgaag
tccagcacctacgaggccaagaaagacatgatcgaaagaagcaaggcagaggtggagaaa
atgacgcagagtggggtggtagcaaataggtacttcaagataatgaaaagacacatggtg
gatggcaaggatgaactggaagggttaaatgaggacagagacgccttcctccataaagcc
atggaaaactacatcagatgtctgaaggcaggggatgagcatgacttgcgtgtcttcagg
ctctgctcgctgtggttcagaaatgcacacaaccctgacatcaaccagctggctaaggag
aactttcctaagcttgagtccaggaagttccttcccctgatctaccagctggctgctcgc
atggggaccaagtctcagggctctcccgactttcaaagcacactgctgcaggttgattct
atgcttttagtaatttcaacgaacttttcaactttgaccacgtcttatacatga

DBGET integrated database retrieval system