KEGG   Bacteroides fragilis YCH46: BF0490Help
Entry
BF0490            CDS       T00202                                 

Definition
(RefSeq) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
bfr00473  D-Alanine metabolism
bfr00550  Peptidoglycan biosynthesis
bfr01100  Metabolic pathways
bfr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bfr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BF0490
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BF0490
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BF0490
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bfr01011]
    BF0490
Enzymes [BR:bfr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BF0490
Peptidoglycan biosynthesis and degradation proteins [BR:bfr01011]
 Precursor biosynthesis
  Amino acid ligase
   BF0490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 ATP-grasp CPSase_L_D2 ATPgrasp_ST GARS_A ATPgrasp_YheCD TTL
Motif
Other DBs
NCBI-GeneID: 3081108
NCBI-ProteinID: YP_097773
UniProt: Q64Z37
LinkDB All DBs
Position
567446..568420
Genome map
AA seq 324 aa AA seqDB search
MKRNIAIVAGGDTSEIVVSLRSAQGIYSFIDKEKYNLYIVEMEGRRWEVQLPDGSKTPVD
RNDFSFINGAEKVVFDFAYITIHGTPGEDGRLQGYFDMMRIPYSCCGVLAAAITYDKFVC
NQYLKAFGVRISESLLLRQGQAVSDEDVVEKIGLPCFIKPNLGGSSFGVTKVKTREQIQP
AIAKAFSEAEEVMIEAFMGGTELTCGCYKTKEKSVVFPLTEVVTHNEFFDYDAKYNGQVD
EITPARISEELTRRVQTLTSAIYDILGCSGIIRVDYIITEGEKINLLEVNTTPGMTATSF
IPQQVRAAGLDIKDVMTDIIENKF
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcaacattgccattgtggcaggaggcgatacctccgaaatcgtagtttccctg
cgtagtgcacagggcatttactcctttatcgacaaggagaagtataatttgtacatcgta
gaaatggaaggtcggcgttgggaagtgcaattgccggacggaagtaaaacaccggtggac
agaaacgactttagttttataaatggggcggagaaggtcgtgttcgactttgcttatatc
accattcacggaacaccgggagaggatggacgtttgcagggctatttcgacatgatgcgt
attccgtattcatgttgtggcgtactggccgctgccatcacttacgataaatttgtctgc
aaccagtatctcaaagcatttggtgtgcgtatctccgaatcgttgttgctacgtcaggga
caggctgtctccgatgaagatgtggtggaaaaaattggcctgccttgctttatcaaaccc
aatctgggaggatccagctttggtgtgactaaggtgaagacgcgcgaacagattcaacct
gccattgccaaggctttcagtgaagctgaggaagtgatgatagaagcctttatgggcgga
acagaattgacttgcggttgttataagacgaaagaaaaatcggtagtctttccgttgact
gaggtcgtgacacataatgaattcttcgattacgatgcaaagtacaacggacaggtggac
gagatcactccggcacgtatatcggaagaactgacccggcgtgtccagactttaacctcg
gctatttacgatatattgggatgttccggcattattcgagtggactatatcattacggaa
ggtgagaagatcaatcttctggaggtgaataccacaccgggtatgaccgctaccagtttt
attccccagcaggtgcgtgccgccggactggatataaaagacgtgatgactgatattata
gaaaataaattttag

DBGET integrated database retrieval system