KEGG   Bacteroides fragilis YCH46: BF0892Help
Entry
BF0892            CDS       T00202                                 

Definition
(RefSeq) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
bfr00473  D-Alanine metabolism
bfr01100  Metabolic pathways
bfr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bfr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BF0892
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BF0892
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bfr01011]
    BF0892
Enzymes [BR:bfr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BF0892
Peptidoglycan biosynthesis and degradation proteins [BR:bfr01011]
 Precursor biosynthesis
  Racemase
   BF0892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C LodA_C
Motif
Other DBs
NCBI-GeneID: 3081531
NCBI-ProteinID: YP_098177
UniProt: Q64XY3
LinkDB All DBs
Position
complement(1068827..1071373)
Genome map
AA seq 848 aa AA seqDB search
MPIGASINVQICQCFNIMSYTIESIVEKIGARRLGNKPAAIDWLLTDSRSLCFPEETLFF
AIPTKRNNGARYIPDLYERGVRNFVVTSEDFKGLTMDSEQLKVTMAQECNFLIVPNTLKA
LQKLAEQHRGSFQIPVVGITGSNGKTIVKEWLHQLLSPDRVIVRSPRSYNSQIGVPLSVW
QMNEESELGIFEAGISEMGEMRPLQNMIKPTIGILTNIGGAHQENFFSLQEKCMEKLSLF
KDCDVVIYNGDNEMISNCVGKSMLTAREIAWSMRDIERPLYISRVEKKEDHTVISYRYLE
MDNTFCIPFIDDASIENSLNCLAACLYLMVPADQITERMARLEPVAMRLEVKDGKNNCIL
INDSYNSDLASLDIALDFLYRRSQSKGLKRTLILSDILETGQSTTTLYRKVAQLVHSRGI
EKIIGVGAEISSCASKFDIEKYFFPDTKALLASDVIKKLRNEIILIKGSRNFGFDLVSEE
LELKVHETILEVNLGAMVANLNHYRSMLKPETKMVCMVKASAYGAGSYEIAKTLQEHHAD
YLAVAVADEGSDLRKAGITASIIIMDPELTAFKTMFDYKLEPEVYNFHLLDALIKAAEKE
GITNFPIHVKLDTGMHRLGFEEKDIPQLIRRLKNQNALIPRSVFSHFVGSDSAQFDAFTR
QQIERYEKMSKELQDAFPHKILRHICNTAGIERFPGAQFDMVRLGIGLYGISPIDNSIIN
NVSTLKTTILQIRDVAEEDTVGYSRKGHLIRPSRIAAIPIGYADGLNRHLGCGHGYCLVN
GKKAPYVGNICMDVCMIDVTDIDCREGDQAIIFGDELPITALSDALETIPYEVLTGISTR
VKRVYYQD
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
gtgccgattggcgcttcaataaatgtgcaaatatgccaatgctttaatattatgtcatat
acaattgaatcaatcgttgaaaaaataggtgcacggcgtctgggaaacaagcctgctgcc
atcgactggctactgactgacagccgttcgttatgttttccggaagagaccctctttttt
gccattcccaccaaaaggaacaacggcgcacgctacatccctgacctttatgaacgggga
gtgcgcaattttgtagtcacaagcgaagatttcaaagggctcaccatggacagtgagcaa
ctaaaagtgacaatggctcaggaatgcaatttccttattgtccccaatactttaaaagca
cttcagaaattggccgaacaacaccgtggttccttccagattccggtagtcggcattacg
ggcagcaatggaaagaccattgtaaaagaatggcttcaccaattgctcagccccgaccgg
gttatcgtgcgttcaccgcgcagctacaattcgcaaatcggtgtcccgctgtcagtctgg
caaatgaacgaggaatccgaactgggcattttcgaagccggcatttcggaaatgggcgaa
atgcgtccgttacagaatatgattaagccgacaataggcatcctgaccaacattggcgga
gcacatcaggaaaacttcttttcactgcaagagaagtgcatggaaaaactaagcctgttt
aaagattgcgacgtagtcatttacaatggcgacaacgaaatgataagcaactgcgtagga
aagtcaatgctgactgcccgtgaaatcgcatggagcatgagggatatcgaacgtccgctc
tatatcagcagggttgagaagaaagaagatcataccgtcatctcctaccgctatctggag
atggacaatacattctgtattccctttatcgatgatgcttccatagagaactcactgaac
tgcctcgctgcctgcctgtacctgatggtaccggccgaccagatcaccgaacgaatggcc
aggctcgaacctgtagcgatgcgccttgaagtaaaagacggaaagaacaactgtatcttg
atcaatgacagttataattcggaccttgcttcgctggatatcgctctcgactttctttac
cggcgttcgcagtcaaaaggcctaaagcgcactttgatcctttcggatatcctggaaacc
ggacaaagcacgacaacactctaccgcaaagtggcacaactggttcacagccgcggcatt
gaaaagattatcggtgtaggtgccgaaatatcctcatgcgcatcaaagtttgatatagaa
aaatatttcttccccgataccaaggcacttctggcatcagatgtaattaagaaactcaga
aatgaaatcatcctgataaaaggctcccgcaacttcggtttcgacctcgtttcggaagaa
ctggaactgaaagtacacgaaaccatcctggaagtaaacctgggagctatggtagccaac
ctgaatcactaccgctcgatgctcaaaccggaaactaaaatggtgtgcatggtgaaagcg
tctgcttatggagcaggttcgtacgaaatagccaaaacccttcaggagcatcacgctgac
tatctggcagtggccgtagccgatgaaggttccgaccttcgcaaagcagggatcacagcc
tccattatcatcatggatcccgaactgaccgctttcaaaaccatgttcgactataaactg
gaaccggaagtatacaatttccatttactcgacgcattgataaaagccgccgaaaaagaa
ggtatcaccaacttccccattcacgtaaaactggatacgggtatgcaccgattgggattc
gaagagaaagacatcccgcaactgattcgccggttaaagaaccagaatgcactgattccc
cgctctgtcttttcccatttcgtaggcagtgattctgcccagttcgacgcttttacccgg
cagcaaatagaacgatatgaaaagatgtcaaaggaactgcaagatgcattcccgcacaaa
atactgcgccatatctgcaacacagccggtatcgaacgcttccccggtgcacagttcgac
atggttcgtcttggcatcggattgtatggaatcagtccgatcgataactcaatcatcaac
aacgtgagtaccttgaaaacaacgattctccaaatacgggacgtggcggaagaagatact
gtaggttatagccgcaaagggcatctgatacgtccctcacgtatcgctgctatacccatc
ggatatgccgacggcctgaaccgccatttgggatgcggacatggctattgccttgttaat
ggcaaaaaagccccatacgtaggaaatatctgcatggatgtgtgcatgatcgacgtaacg
gatattgattgtagagaaggtgatcaagctatcatcttcggtgacgaattaccgattacc
gccttatcggatgcgctcgaaaccatcccttatgaagtattgacaggtatttcaacccgg
gtcaagagagtatattatcaagattaa

DBGET integrated database retrieval system