KEGG   Bacteroides fragilis YCH46: BF1191Help
Entry
BF1191            CDS       T00202                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
bfr00500  Starch and sucrose metabolism
bfr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BF1191
Enzymes [BR:bfr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BF1191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C
Motif
Other DBs
NCBI-GeneID: 3082936
NCBI-ProteinID: YP_098475
UniProt: Q64X35
LinkDB All DBs
Position
1425227..1427386
Genome map
AA seq 719 aa AA seqDB search
MKNMKKLTFKLACFFLSLLVSSVAMAESITSPNGLLKLNVSVNEKGEPVYELSYKGKEVI
KPSKLGLELKDDPGLMDGFTLSDAKTSSFDETWEPVWGEVKQIRNNYNELAITLDQKAQD
RKMVIRFRLYNDGLGFRYEFPQQKNLNYFVIKEEHSQFAMAGDHTAFWIPGDYDTQEYDY
TRSKLSEIRGLMKTAVTPNASQTPFSPTGVQTALQMKTDDGLYINLHEAALVDYSCMHLN
LDDKNFVFESWLTPDAQGTKGYMQTPCHSPWRTIMVSDDARDILASKLTLNLNEPCKLED
TSWIKPVKYVGVWWEMITGKSTWAYTDDVYSVKLGETDYTKTKPNGRHGANNENVKRYID
FAAEHGFDQVLVEGWNEGWEDWFGKSKDYVFDFVTPYPDFDVKMLNEYARSKGVKLMMHH
ETSASVRNYERHMDEAYQFMEDNGYNAVKSGYVGNIIPRGEHHYGQWLNNHYLYAVKKAA
DHKIMVNAHEAVRPTGLCRTYPNLIGNESARGTEYEAFGGNKPFHTTLLPFTRLIGGPMD
YTPGIFDTQLSFLSGEHSFVHTTLAKQLALYVTLYSPLQMAADLPESYERYMDAFQFIKD
VAVDWDESKYIEAEPGEYITVARKAKNTNNWFVGGITGENARTSTFVLDFLEPGKQYVAT
LYADGKDADYEKNPTSYQIKKGLVTYKTKISTDLARSGGFAISLIEATPADKKELKKWK
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacatgaaaaaactgacttttaagttagcttgcttttttctctctcttttagtg
agtagtgtggcaatggccgaaagtattacttctcccaacggactcttgaaactgaatgta
tctgtgaatgagaagggggaacctgtgtatgaactttcttataaaggtaaagaagtgatt
aaaccttctaaactgggtcttgaactgaaagacgatccggggttgatggacggttttacg
ttgtctgatgccaaaacttcttcttttgacgagacttgggagcctgtttggggcgaggtt
aagcaaattcgcaataattataatgaacttgcgattactttagaccagaaagctcaggat
cgcaaaatggtgattcgttttcgtctgtataatgacggactcggatttcgctacgaattt
ccacaacaaaagaatctgaattattttgtaattaaagaggaacattctcaatttgctatg
gccggtgatcatacggctttctggataccgggagattatgatacgcaggaatatgattat
actcggtcgaaactttctgaaatacgcggcttaatgaagacggctgtcactcccaatgct
tctcaaactcctttttctcctaccggtgtacagactgctttgcagatgaaaacagacgac
gggttgtatatcaatctgcacgaagctgctttggtggattattcttgcatgcatctcaat
ctggacgataagaattttgttttcgaatcgtggttgactcctgatgctcaagggaccaaa
ggatatatgcaaactccttgccactctccatggcgtacgattatggttagtgatgatgcg
cgtgatattcttgcttctaaattaacattaaatctgaacgagccttgcaaactggaggat
acttcctggattaagcctgtaaaatacgtaggtgtatggtgggaaatgattaccggaaag
agtacttgggcttatacggatgatgtttattcagtgaagttgggcgaaaccgattatact
aaaactaagcctaatggtcgtcatggtgccaataatgagaacgtgaaacgttatattgat
tttgctgccgaacacggttttgatcaggtgctggtcgagggctggaatgaaggctgggaa
gactggttcggcaagtcaaaagactatgtgttcgacttcgttactccgtatcctgatttt
gatgtgaaaatgttgaatgagtatgctagaagtaaaggagtgaagctgatgatgcatcat
gagacttctgcatctgtgcgtaactatgaacgtcatatggatgaagcttatcaatttatg
gaagataacggttacaatgcggtgaagagtggatatgttggcaatatcatcccgcgtggt
gaacaccactacggtcaatggctgaataatcattatctgtatgcagtgaagaaagctgcg
gatcataaaattatggtgaatgcacacgaggctgttcgccctaccggattgtgccgtaca
tatccgaatctgattggtaatgaatctgcccgtggtacagaatatgaagccttcggaggc
aataagcctttccatactacgttgcttccatttacgcgtctgataggtggtccgatggat
tatactccgggtattttcgatactcaactctctttcctgagtggtgagcatagttttgta
catactactttggccaaacagttggctttgtatgtcactctttatagcccattacagatg
gctgccgatcttccggagagttatgaacgctatatggatgcctttcagtttattaaagat
gtagcagtagactgggatgaaagtaagtatattgaagcagaaccgggagagtacatcact
gtggcccgtaaagctaaaaacaccaataattggttcgttggaggaattactggtgaaaat
gcacgcacatctacgtttgtgcttgatttcctggaaccgggaaagcaatatgtagctact
ttatatgccgatggtaaagatgcggattatgaaaaaaatccgacttcttatcagattaaa
aaaggtctggtgacttataagacgaagatttccactgacttggcccgtagtggaggtttt
gctattagtttgatagaggctacccctgccgataagaaagaacttaaaaagtggaaataa

DBGET integrated database retrieval system