KEGG   Bacteroides fragilis YCH46: BF1258Help
Entry
BF1258            CDS       T00202                                 

Definition
(RefSeq) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bfr  Bacteroides fragilis YCH46
Brite
KEGG Orthology (KO) [BR:bfr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BF1258
Enzymes [BR:bfr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BF1258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox HI0933_like FAD_binding_2 GIDA FAD_oxidored Thioredoxin_3 DAO Thi4 NAD_binding_8 Thioredoxin_4 NAD_binding_7 AlaDh_PNT_C Lycopene_cycl Glutaredoxin DSBA FAD_binding_3 K_oxygenase
Motif
Other DBs
NCBI-GeneID: 3082794
NCBI-ProteinID: YP_098542
UniProt: Q64WW8
LinkDB All DBs
Position
complement(1495743..1497293)
Genome map
AA seq 516 aa AA seqDB search
MLDSAIKEQLRTIFAALEANYTFDITVSPQHESRTELLELLNDVASCSEKLSCRINEGKG
LEFTLLKGEHRTGITFRAVPNGHEFSSLLLAILNTDGKGKNFPDEGICNRVKSLKGPVRL
TTYVSLTCTNCPDVVQALNAMTTLNRQIQHQTVDGAINQAEVEALKIQGVPSVFADGKLI
HVGRGDFGELLAKLEEQYGTETNSAETSIKKYDVIVAGGGPAGSAAAIYSARKGLNVAVI
AERIGGQVKETVGIENLISVPSTTGSQLADNLKTHMSQYPIDLLEHRQIEKIELDGKDKV
LTAKGGERFSAPAVIVATGASWRKLNVPGEAEYIGRGVAFCPHCDGPFYKGKQVAVVGGG
NSGIEAAIDLAGICSKVTVLEFMDELKADQVLQEKLKSLPNVEVLVHSQTTEVVGNGDKV
TGIRVKDRKTEEERVISLDGIFVQIGLVANSGIFRDVVEVNRPGEIVIDAHCRTNVPGIY
AAGDVSTVPYKQIIIAMGEGAKAALAAFEDRMRGEI
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgttagactcagctataaaagaacaattacgtaccatcttcgccgcattggaggcgaac
tatacattcgacatcaccgtctcaccgcaacacgaaagccgcaccgaacttctggaactc
ctgaacgatgtggcatcctgctccgagaaactctcttgccggatcaatgaaggcaaagga
ctggaatttacacttctcaaaggagaacacaggacaggtatcaccttccgggccgttccc
aatgggcatgaattcagttctttactgcttgccatcctgaatacggacggaaaaggaaag
aactttccggacgaaggcatctgcaaccgggtaaaatcattgaaaggacctgtccgcctg
acaacttacgtgtcactgacctgtaccaactgccccgacgtggtgcaggcactcaacgcc
atgaccacgctgaacagacagattcagcaccagactgtggacggagccatcaaccaggcg
gaagtagaggcactgaaaatacagggggttccttctgtcttcgcagacggtaaactgatc
cacgtggggcgtggtgactttggcgaactgttggccaaactggaagaacaatatggaacg
gagacgaacagtgcggaaacttccatcaaaaaatatgatgtgattgtagccggcggaggt
ccggccggttcggctgctgccatctattcggcccgtaaaggcttgaatgtagcggtcatt
gccgaacggatcggcggacaagtaaaagaaacagtaggcatagagaacctgatctccgta
ccttcgacaaccggaagccagttggccgataatctgaaaacccacatgtcacaatatccc
atcgatttgctcgaacatcgccagatcgaaaagatagagcttgatggaaaggataaggtt
ctgacagccaaaggaggagaacgtttctcagctccggcggtaatcgttgccaccggtgca
agctggcgcaaactgaacgtaccgggcgaagcggaatatatcggccgtggggtggctttc
tgtccacactgcgacggacctttctacaaagggaaacaggtggctgtcgtgggaggagga
aattccggaatcgaagcagccatcgacctggcaggtatctgctccaaagttacggtgctc
gagtttatggacgagctgaaagcggatcaggttttacaggaaaaactgaaaagcctgccg
aatgtagaagttcttgttcactcgcagacaaccgaagtggtaggcaatggagataaggtg
accggcatccgtgtcaaagaccgcaaaacagaagaagaacgggtgatcagcctggatggc
atctttgtacagataggtttggtagccaatagtggtattttccgcgatgtggttgaggta
aatcgtccgggcgagatcgtgatcgatgcacattgccgtaccaacgtgccgggaatttat
gctgccggagacgtttccaccgtcccctacaaacagattatcatcgcaatgggagaaggc
gccaaagccgcattagccgcattcgaggatcggatgcgaggagaaatttaa

DBGET integrated database retrieval system