KEGG   Bacteroides fragilis YCH46: BF3492
Entry
BF3492            CDS       T00202                                 

Definition
(RefSeq) putative alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
bfr  Bacteroides fragilis YCH46
Pathway
bfr00052  Galactose metabolism
bfr00500  Starch and sucrose metabolism
bfr01100  Metabolic pathways
bfr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bfr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BF3492
   00500 Starch and sucrose metabolism
    BF3492
Enzymes [BR:bfr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     BF3492
SSDB
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C DUF4537
Other DBs
NCBI-GeneID: 3084574
NCBI-ProteinID: YP_100769
UniProt: Q64QJ6
LinkDB
Position
complement(3987348..3989297)
AA seq 649 aa
MKKQLLLLLIFSISLYIQGQNIHKLASPDGNIQISVNLSDKIYYDVICRNETLLKQCHLA
MEIGDQELGTNPKMTKVSHKNIDESLKPVIPLKFSSVSNRYNQLLLDFKGGYSVEFRAFN
DGIAYRFITNKKGMINVKNETLQVNFPDNYLLHMQQSGSFKTAYEEEYTHLYSKEWKSSA
SMALLPILIDTQKGSKILISETSLTDYPAVFLKSNGSNGMVSVFPRVPLEFGEDGDRSVK
ILKEADYIAQTSGKRNFPWRYFVISTEDSQLIENTMSYRLAEKNILEDTSWIKPGLASWE
WWNGATPYGPDVNFVAGCNLDTYKYFIDFAANYGIPYIIMDEGWAMSTRDPYTPNPAVDV
HELIRYGKEKNVGIVLWLTWLTVENNFGLFETFEKWGVKGVKIDFMDRSDQWMVNYYERV
AREAAKHHLFVDFHGAFKPAGLEYKYPNVLSYEGVRGMEQMGGCRPDNSIYLPFMRNAVG
AMDYTPGAMLSMQPEIYCSERPNSASIGTRAYQMALFVIFESGLQMMADNPTLYYRNDEC
TRYITQVPQTWDETIALKAKAGEYVIVAKRKGDKWYIGGMTNNRQQERTFELDFDFLKEG
QSYRMTSFEDGVNANRQAMDYRKKEYTLKKGDKIIVRLARNGGFASVIE
NT seq 1950 nt   +upstreamnt  +downstreamnt
atgaaaaaacaattactgctgctattaatttttagtatttctttgtatattcagggacag
aacatacacaagctggcttcgccggatgggaatattcagatttcagtgaatctttcagat
aaaatctactacgatgtcatttgccggaatgagacattgttaaagcagtgtcaccttgca
atggaaatcggtgaccaggaattgggaacgaatcctaaaatgactaaagtaagccataag
aatatagacgagtctttaaagcctgttattccattgaaattttcgtctgtaagtaatcgg
tacaaccaacttcttctagacttcaaaggaggttattccgtagagtttcgtgccttcaat
gacggaattgcctaccgttttataaccaataagaaaggaatgatcaatgtgaagaatgag
accctccaagtgaacttccctgataattatttgctacacatgcaacagtccggaagtttt
aaaacggcttatgaagaagaatatacccatttgtatagcaaagaatggaaatcatctgcc
tcaatggctttattgccaattctgattgatactcaaaaaggaagtaagatattaatcagt
gaaacatcactaaccgattatccggctgtttttctgaaaagtaatggcagcaatggtatg
gtttctgtatttcccagagtacctcttgaatttggagaagacggtgatcggagtgtcaaa
atactgaaagaagccgactatatagcacaaaccagtggaaagcgtaatttcccttggcgc
tattttgtcattagtacagaagatagccaactcattgagaatacgatgtcttatagattg
gccgaaaagaacatattggaagatacttcctggattaagcccggattggcaagctgggaa
tggtggaacggtgctactccctacggaccggatgttaattttgtagcaggatgcaatctc
gatacttacaaatattttattgattttgctgctaattatggtataccatatattattatg
gacgagggctgggctatgagtacccgtgatccctatacaccaaatcctgcggtagatgtg
catgaactcattcgttatggcaaagaaaaaaatgtaggcattgtgctttggttgacatgg
ctcactgtagaaaacaatttcgggctgtttgagactttcgagaaatggggtgtgaaggga
gtcaaaatcgacttcatggacagaagtgaccagtggatggtgaattattatgaaagagta
gcccgagaggctgccaagcaccatctgtttgtcgattttcatggggcatttaagcctgcc
ggattggaatataagtatccgaatgtattgtcttatgagggcgtaagaggaatggaacaa
atgggtggatgtcgaccggacaacagcatatatctgccttttatgagaaatgcggttggt
gcaatggactatacgccgggtgccatgcttagtatgcaaccggaaatttattgttccgaa
cgtcctaattcagccagtataggtacacgagcttaccaaatggctttatttgttattttc
gaaagtgggttgcagatgatggcggacaatcctacactttactatcgcaatgacgaatgt
acccgatatattactcaagtcccgcagacatgggatgaaaccattgctttgaaagctaag
gctggggaatatgtgattgtggcaaaacgtaaaggagataagtggtatatcggtggcatg
actaacaaccgacagcaagagagaacctttgaattggattttgacttcctgaaagaagga
caatcttatcggatgacttcttttgaggatggggttaatgctaaccgacaagctatggat
tacagaaaaaaagaatatactcttaaaaaaggagataaaataatagtgcgtctggcacgt
aacggaggatttgcctctgtcattgagtga

DBGET integrated database retrieval system