KEGG   Bacteroides fragilis YCH46: BF4199Help
Entry
BF4199            CDS       T00202                                 

Definition
(RefSeq) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bfr  Bacteroides fragilis YCH46
Brite
Translation factors [BR:bfr03012]
 Eukaryotic Type
  Elongation factors
   BF4199
 Prokaryotic Type
   BF4199
Mitochondrial biogenesis [BR:bfr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BF4199
Exosome [BR:bfr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BF4199
  Exosomal proteins of breast cancer cells
   BF4199
  Exosomal proteins of colorectal cancer cells
   BF4199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-GeneID: 3085281
NCBI-ProteinID: YP_101476
UniProt: P33165
LinkDB All DBs
Position
complement(4793864..4795048)
Genome map
AA seq 394 aa AA seqDB search
MAKEKFERTKPHVNIGTIGHVDHGKTTLTAAITTVLAKKGLSELRSFDSIDNAPEEKERG
ITINTSHVEYETANRHYAHVDCPGHADYVKNMVTGAAQMDGAIIVVAATDGPMPQTREHI
LLARQVNVPKLVVFMNKCDMVEDAEMLELVEMEMRELLSFYDFDGDNTPIIQGSALGALN
GVEKWEDKVMELMEAVDTWIPLPPRDVDKPFLMPVEDVFSITGRGTVATGRIETGVIHVG
DEIEILGLGEDKKSVVTGVEMFRKLLDQGEAGDNVGLLLRGVDKNEIKRGMVLCKPGQIK
PHSKFKAEVYILKKEEGGRHTPFHNKYRPQFYLRTMDCTGEITLPEGTEMVMPGDNVTIT
VELIYPVALNIGLRFAIREGGRTVGAGQITEIID
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagagaaatttgaacgtaccaaaccgcacgtaaacattggtacaatcggtcac
gttgaccacggtaaaaccactttgactgctgctatcactactgtgttggcaaagaaaggt
ctttctgaacttcgttctttcgattctatcgataatgctcctgaagaaaaagaaagaggt
attactatcaatacttcacacgttgagtatgaaactgctaaccgtcactacgcacacgtt
gactgtccgggtcacgctgactacgtaaagaacatggttactggtgctgctcagatggac
ggtgctatcattgtagttgctgctactgatggtccgatgcctcagactcgtgagcacatc
cttttggctcgtcaggtaaacgttccgaagctggttgtattcatgaacaagtgcgatatg
gttgaagatgctgagatgttggaacttgttgaaatggaaatgagagaattgctttcattc
tatgatttcgacggtgacaatactccgatcattcagggttctgctcttggtgcattgaac
ggcgtagaaaaatgggaagacaaagtaatggaactgatggaagctgttgatacttggatt
ccactgcctccgcgcgatgttgataaacctttcttgatgccggtagaagatgtgttctct
atcacaggtcgtggtactgtagctacaggtcgtatcgaaactggtgttatccatgtaggt
gatgaaatcgaaatcctcggtttgggtgaagataagaaatcagttgtaacaggtgttgaa
atgttccgcaaacttctggatcagggtgaagctggtgacaacgtaggtctgttgcttcgt
ggtgttgacaagaacgaaatcaaacgtggtatggttctttgtaagccgggtcagattaaa
cctcactctaaattcaaagcagaggtttatatcctgaagaaagaagaaggtggtcgtcac
actccattccataacaaatatcgtcctcagttctatctgcgtactatggactgtacaggt
gaaatcactcttccggaaggaactgaaatggtaatgccgggtgataacgtaaccatcact
gtagagttgatctatccggttgcactgaacatcggtcttcgtttcgctatccgcgaaggt
ggacgtacagtaggtgctggtcagattactgaaattatcgactaa

DBGET integrated database retrieval system