KEGG   Bacteroides fragilis NCTC9343: BF9343_0311Help
Entry
BF9343_0311       CDS       T00239                                 

Definition
(GenBank) putative peptidase/deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
bfs  Bacteroides fragilis NCTC9343
Pathway
bfs00220  Arginine biosynthesis
bfs01100  Metabolic pathways
bfs01110  Biosynthesis of secondary metabolites
bfs01130  Biosynthesis of antibiotics
bfs01210  2-Oxocarboxylic acid metabolism
bfs01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bfs00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BF9343_0311
Enzymes [BR:bfs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     BF9343_0311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: CAH06090
GeneDB: BF0319
UniProt: Q5LID6
LinkDB All DBs
Position
complement(375781..376842)
Genome map
AA seq 353 aa AA seqDB search
MIDESITSEAVGLLKSLISIPSLSREEEKAADYLQNYIEAEGMTTGRKGNNIWCLSPMFD
LKKPTILLNSHIDTVKPVNGWRKDPFTPREENGKLYGLGSNDAGASVVTLLQVFLQLCRK
QQSYNLIYLASCEEEVSGKGGIESVLPGLPPISFAVVGEPTEMQPAIAEKGLMVLDVTAT
GKAGHAARNEGDNAIYKVLDDIAWFRDYRFAKESPLLGPVKMSVTVINAGTQHNVIPDRC
SFVVDVRSNELYSNEELFTEIQKHISCKAEARSFRLNSSRIEESHPFVQKAKKLGRVPFG
SPTLSDQALMVFPSVKIGPGRSSRSHTADEYIMIKEIEEALELYLKILDGLEI
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgatagacgaatccattacatccgaagctgtcggcttgctgaaatctcttatcagcatc
ccttcgctcagccgcgaagaagaaaaagcagccgactatctgcaaaattatatcgaggcc
gaaggcatgaccacgggccgtaaaggaaacaatatctggtgcctgagccctatgttcgac
ctgaaaaagccgacaatcctgctcaactcccatattgacactgtaaagccggtcaacggt
tggcggaaagatccgttcactccacgcgaagagaatggaaaactttatggattgggcagc
aatgatgccggtgccagtgtagtaacactcctacaggtgtttctgcaactatgccgcaaa
caacaaagttataaccttatttatctggcttcctgcgaagaagaggtatccggaaaaggc
ggtatcgaaagtgtattaccgggacttccccccatcagttttgccgtagtaggagaaccc
accgaaatgcaacctgccattgccgaaaaaggcctgatggtgctcgatgtcacagctacc
ggaaaagcaggacacgccgcccgcaatgaaggtgacaatgcgatatataaagtactggac
gatattgcctggttccgcgactaccgctttgcaaaagaatcaccattactgggacctgtc
aaaatgagtgttacggtgatcaatgccggtacgcagcacaatgtcattcccgaccgttgc
agttttgtagtagatgtgcgtagcaacgaactgtactctaacgaagagttgtttactgaa
atacaaaagcatatctcttgtaaagctgaagcccgttcgttccgcctcaactcttcacgt
atcgaagaaagccacccgtttgtacagaaagcaaagaaactgggacgcgtgcctttcggc
tctcctactctctcggatcaagctttaatggtgttcccctcagtcaagataggccccggc
cgttcttcacgttcgcatacggccgatgaatatatcatgattaaagaaatagaagaggca
ttggaattgtatttgaagatactggacggactggaaatctga

DBGET integrated database retrieval system