KEGG   Bacteroides fragilis NCTC9343: BF9343_0779Help
Entry
BF9343_0779       CDS       T00239                                 

Definition
(GenBank) putative alanine racemase and UDP-N-acetylmuramoylalanyl-D-glutamyl, 6-diaminopimelate-D-alanyl-D-alanyl ligase fusion protein
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bfs  Bacteroides fragilis NCTC9343
Pathway
bfs00473  D-Alanine metabolism
bfs01100  Metabolic pathways
bfs01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bfs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BF9343_0779
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BF9343_0779
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bfs01011]
    BF9343_0779
Enzymes [BR:bfs01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BF9343_0779
Peptidoglycan biosynthesis and degradation proteins [BR:bfs01011]
 Precursor biosynthesis
  Racemase
   BF9343_0779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C LodA_C
Motif
Other DBs
NCBI-ProteinID: CAH06560
GeneDB: BF0816
UniProt: Q5LH26
LinkDB All DBs
Position
complement(1008069..1010591)
Genome map
AA seq 840 aa AA seqDB search
MQICQCFNIMSYTIESIVEKIGARRLGNKPAAIDWLLTDSRSLCFPEETLFFAIPTKRNN
GARYIPDLYERGVRNFVVTSEDFKGLTMDSEQLKVTMAQECNFLIVPNTLKALQKLAEQH
RGSFQIPVVGITGSNGKTIVKEWLHQLLSPDRVIVRSPRSYNSQIGVPLSVWQMNEESEL
GIFEAGISEMGEMRPLQNMIKPTIGILTNIGGAHQENFFSLQEKCMEKLSLFKDCDVVIY
NGDNEMISNCVGKSMLTAREIAWSMRDIERPLYISRVEKKEDHTVISYRYLEMDNTFCIP
FIDDASIENSLNCLAACLYLMVPADQITERMARLEPVAMRLEVKDGKNNCILINDSYNSD
LASLDIALDFLYRRSQSKGLKRTLILSDILETGQSTTTLYRKVAQLVHSRGIEKIIGVGA
EISSCASKFDIEKYFFPDTKALLASDVIKKLRNEIILIKGSRNFGFDLVSEELELKVHET
ILEVNLGAMVANLNHYRSMLKPETKMVCMVKASAYGAGSYEIAKTLQEHHADYLAVAVAD
EGSDLRKAGITASIIIMDPELTAFKTMFDYKLEPEVYNFHLLDALIKAAEKEGITNFPIH
VKLDTGMHRLGFEEKDIPQLIRRLKNQNALIPRSVFSHFVGSDSAQFDAFTRQQIERYEK
MSKELQDAFPHKILRHICNTAGIERFPGAQFDMVRLGIGLYGISPIDNSIINNVSTLKTT
ILQIRDVAEEDTVGYSRKGHLIRPSRIAAIPIGYADGLNRHLGCGHGYCLVNGKKAPYVG
NICMDVCMIDVTDIDCREGDQAIIFGDELPITVLSDALETIPYEVLTGISTRVKRVYYQD
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaatatgccaatgctttaatattatgtcatatacaattgaatcaatcgttgaaaaa
ataggtgcacggcgtctgggaaacaagcctgctgccatcgactggctactgactgacagc
cgttcgttatgttttccggaagagaccctcttttttgccattcccaccaaaaggaacaac
ggcgcacgctacatccctgacctttatgaacggggagtgcgcaattttgtagtcacaagc
gaagatttcaaagggctcaccatggacagtgagcaactaaaagtgacaatggctcaggaa
tgcaatttccttattgtccccaatactttaaaagcacttcagaaattggccgaacaacac
cgtggttccttccagattccggtagtcggcattacgggcagcaatggaaagaccattgta
aaagaatggcttcaccaattgctcagccccgaccgggttatcgtgcgttcaccgcgcagc
tacaattcgcaaatcggtgtcccgctgtcagtctggcaaatgaacgaggaatccgaactg
ggcattttcgaagccggcatttcggaaatgggcgaaatgcgtccgttacagaatatgatt
aagccgacaataggcatcctgaccaacattggcggagcacatcaggaaaacttcttttca
ctgcaagagaagtgcatggaaaaactaagcctgtttaaagattgcgacgtagtcatttac
aatggcgacaacgaaatgataagcaactgcgtaggaaagtcaatgctgactgcccgtgaa
atcgcatggagcatgagggatatcgaacgtccgctctatatcagcagggttgagaagaaa
gaagatcataccgtcatctcctaccgctatctggagatggacaatacattctgtattccc
tttatcgatgatgcttccatagagaactcactgaactgcctcgctgcctgcctgtacctg
atggtaccggccgaccagatcaccgaacgaatggcccggctcgaacctgtagcgatgcgc
cttgaagtaaaagacggaaagaacaactgtatcttgatcaatgacagttataattcggac
cttgcttcgctggatatcgctctcgactttctttaccggcgttcgcagtcaaaaggccta
aagcgcactttgatcctttcggatatcctggaaaccggacaaagcacgacaacactctac
cgcaaagtggcacaactggttcacagccgcggcattgaaaagattatcggtgtaggtgcc
gaaatatcctcatgcgcatcaaagtttgatatagaaaaatatttcttccccgataccaag
gcacttctggcatcagatgtaattaagaaactcagaaatgaaatcatcctgataaaaggc
tcccgcaacttcggtttcgacctcgtttcggaagaactggaactgaaagtacacgaaacc
atcctggaagtaaacctgggagctatggtagccaacctgaatcactaccgctcgatgctc
aaaccggaaactaaaatggtgtgcatggtgaaagcgtctgcttatggagcaggttcgtac
gaaatagccaaaacccttcaggagcatcacgctgactatctggcagtggccgtagccgat
gaaggttccgaccttcgcaaagcagggatcacagcctccattatcatcatggatcccgaa
ctgaccgctttcaaaaccatgttcgactataaactggaaccggaagtatacaatttccat
ttactcgacgcattgataaaagccgccgaaaaagaaggtatcaccaacttccccattcac
gtaaaactggatacgggtatgcaccgattgggattcgaagagaaagacatcccgcaactg
attcgccggttaaagaaccagaatgcactgattccccgctctgtcttttcccatttcgta
ggcagtgattctgcccagttcgacgcttttacccggcagcaaatagaacgatatgaaaag
atgtcaaaggaactgcaagatgcattcccgcacaaaatactgcgccatatctgcaacaca
gccggtatcgaacgcttccccggtgcacagttcgacatggttcgtcttggcatcggattg
tatggaatcagtccgatcgataactcaatcatcaacaacgtgagtaccttgaaaacaacg
attctccaaatacgggacgtggcggaagaagatactgtaggttatagccgcaaagggcat
ctgatacgcccctcacgtatcgctgctatacccatcggatatgccgacggcctgaaccgc
catttgggatgcggacatggctattgccttgtcaatggcaaaaaagccccatacgtagga
aatatctgcatggatgtgtgcatgatcgacgtaacggatattgattgtagagaaggtgat
caagctatcatcttcggtgacgaattaccgattaccgtcttatcggatgcgctcgaaacc
atcccttatgaagtattgacaggcatttcaacccgggtcaagagagtatattatcaagat
taa

DBGET integrated database retrieval system