KEGG   Bacteroides fragilis NCTC9343: BF9343_1099Help
Entry
BF9343_1099       CDS       T00239                                 

Gene name
susB
Definition
(GenBank) putative alpha-glucosidase
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
bfs  Bacteroides fragilis NCTC9343
Pathway
bfs00500  Starch and sucrose metabolism
bfs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BF9343_1099 (susB)
Enzymes [BR:bfs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BF9343_1099 (susB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C
Motif
Other DBs
NCBI-ProteinID: CAH06880
GeneDB: BF1158
UniProt: Q5LG61
LinkDB All DBs
Position
1415054..1417225
Genome map
AA seq 723 aa AA seqDB search
MNHIMKNMKKLTFKLACFFLSLLVSSVAMAESITSPNGLLKLNVSVNEKGEPVYELSYKG
KEVIKPSKLGLELKDDPGLMDGFTLSDAKTSSFDETWEPVWGEVKQIRNNYNELAITLDQ
KAQDRKMVIRFRLYNDGLGFRYEFPQQKNLNYFVIKEEHSQFAMAGDHTAFWIPGDYDTQ
EYDYTRSKLSEIRGLMKTAVTPNASQTPFSPTGVQTALQMKTDDGLYINLHEAALVDYSC
MHLNLDDKNFVFESWLTPDAQGTKGYMQTPCHSPWRTVMVSDDARDILASKLTLNLNEPC
KLEDTSWIKPVKYVGVWWEMITGKSTWAYTDDVYSVKLGETDYTKTKPNGRHGANNENVK
RYIDFAAEHGFDQVLVEGWNEGWEDWFGKSKDYVFDFVTPYPDFDVKMLNEYARSKGVKL
MMHHETSASVRNYERHMDEAYQFMEDNGYNAVKSGYVGNIIPRGEHHYGQWLNNHYLYAV
KKAADHKIMVNAHEAVRPTGLCRTYPNLIGNESARGTEYEAFGGNKPFHTTLLPFTRLIG
GPMDYTPGIFDTQLSFLSGEHSFVHTTLAKQLALYVTLYSPLQMAADLPESYERYMDAFQ
FIKDVAVDWDESKYIEAEPGEYITVARKAKNTNNWFVGGITGENARTSTFVLDFLEPGKQ
YVATLYADGKDADYEKNPTSYQIKKGLVTYKTKISTDLARSGGFAISLIEATPADKKALK
KWK
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
ttgaaccatatcatgaagaacatgaaaaaactgacttttaagttagcttgcttttttctc
tctcttttagtgagtagtgtggcaatggccgaaagtattacttctcccaacggactcttg
aaactgaatgtatctgtgaatgagaagggggaacctgtgtatgaactttcttataaaggt
aaagaagtgattaaaccttctaaactgggtcttgaactgaaagacgatccggggttgatg
gacggttttacgttgtctgatgccaaaacttcttcttttgacgagacttgggagcctgtt
tggggcgaggttaagcaaattcgcaataattataatgaacttgcgattactttagaccag
aaagctcaggatcgcaaaatggtgattcgttttcgtctgtataatgacggactcggattt
cgctacgaatttccacaacaaaagaatctgaattattttgtaattaaagaggaacattct
caatttgctatggccggtgatcatactgctttctggataccgggagattatgatacgcag
gaatatgattatactcggtcgaaactttctgaaatacgcggcttaatgaagacggctgtc
actcccaatgcttctcaaactcctttttctcctaccggtgtacagactgctttgcagatg
aaaacagacgacgggttgtatatcaatctgcacgaagctgctttggtggattattcttgc
atgcatctcaatctggacgataagaattttgttttcgaatcgtggttgactcctgatgcc
caagggaccaaaggatatatgcaaactccttgccactctccatggcgtacggttatggtt
agtgatgatgcgcgtgatattcttgcttctaaattaacattaaatctgaacgagccttgc
aaactggaggatacttcctggattaagcctgtaaaatacgtaggtgtatggtgggaaatg
attaccggaaagagtacttgggcctatacggatgatgtttattcagtgaagttgggcgaa
accgattatactaaaactaagcctaatggtcgtcatggtgccaataatgagaacgtgaaa
cgttatattgattttgctgccgaacacggttttgatcaggtgctggttgaaggctggaat
gaaggctgggaagattggttcggcaagtcaaaagactatgtgttcgacttcgttactccg
tatcctgattttgatgtgaaaatgttgaatgagtatgctagaagtaaaggagtgaagctg
atgatgcatcatgagacttctgcatctgtgcgtaactatgaacgtcatatggatgaagct
tatcaatttatggaagataacggttacaatgcggtgaagagtggatatgttggcaatatc
atcccacgtggtgaacaccactacggtcaatggctgaataatcattatctgtatgcggtg
aagaaagctgcggatcataaaattatggtgaatgcacacgaggctgttcgccctaccgga
ttgtgccgtacatatccgaatctgattggtaatgaatctgcccgtggtacagaatatgaa
gccttcggaggcaataagcctttccatactacgttgcttccatttacgcgtctgataggt
ggtccgatggattatactccgggtattttcgatactcaactctctttcctgagtggtgag
catagttttgtacatactactttggccaaacagttggctttgtatgtcactctttatagc
ccattacagatggctgccgatcttccggagagttatgaacgctatatggatgcctttcag
tttattaaagatgtagcagtagactgggatgaaagtaagtatattgaagcagaaccggga
gagtacatcactgtggcccgtaaagctaaaaacaccaataattggttcgttggaggaatt
actggtgaaaatgcacgcacatctacgtttgtacttgatttcctggaaccgggaaagcaa
tatgtagctactttatatgccgatggtaaagatgcggattatgaaaagaatccgacttct
tatcagattaaaaaaggtctggtgacttataagacgaagatttccactgacttggcccgt
agtggaggttttgctattagtttgatagaggctacccctgccgataagaaagcacttaaa
aagtggaaataa

DBGET integrated database retrieval system