KEGG   Bacteroides fragilis NCTC 9343: BF9343_1148Help
Entry
BF9343_1148       CDS       T00239                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bfs  Bacteroides fragilis NCTC 9343
Brite
KEGG Orthology (KO) [BR:bfs00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BF9343_1148 (ahpF)
Enzymes [BR:bfs01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BF9343_1148 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox HI0933_like FAD_binding_2 GIDA FAD_oxidored Thioredoxin_3 DAO Thi4 NAD_binding_8 NAD_binding_7 Thioredoxin_4 AlaDh_PNT_C Lycopene_cycl Glutaredoxin DSBA FAD_binding_3 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: CAH06929
GeneDB: BF1209
UniProt: Q5LG12
LinkDB All DBs
Position
complement(1472142..1473692)
Genome map
AA seq 516 aa AA seqDB search
MLDSAIKEQLRTIFAALEANYTFDITVSPQHESRTELLELLNDVASCSEKLSCRINEGKG
LEFTLLKGEHRTGITFRAVPNGHEFSSLLLAILNTDGKGKNFPDEGICNRVKSLKGPVRL
TTYVSLTCTNCPDVVQALNAMTTLNGQIQHQTVDGAINQAEVEALKIQGVPSVFADGKLI
HVGRGDFGELLAKLEEQYGTETNSAETSIKKYDVIVAGGGPAGSAAAIYSARKGLNVAVI
AERIGGQVKETVGIENLISVPSTTGSQLADNLKTHMSQYPIDLLEHRQIEKIELDGKDKV
LTAKGGERFSAPAVIVATGASWRKLNVPGEAEYIGRGVAFCPHCDGPFYKGKQVAVVGGG
NSGIEAAIDLAGICSKVTVLEFMDELKADQVLQEKLKSLPNVEVLVHSQTTEVVGNGDKV
TGIRVKDRKTEEERVISLDGIFVQIGLVANSGIFRDVVEVNRPGEIVIDAHCRTNVPGIY
AAGDVSTVPYKQIIIAMGEGAKAALAAFEDRMRGEI
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgttagactcagctataaaagaacaattacgtaccatcttcgccgcattggaggcgaac
tatacattcgacatcaccgtctcaccgcaacacgaaagccgcaccgaacttctggaactc
ctgaacgatgtggcatcctgctccgagaaactctcttgccggatcaatgaaggcaaagga
ctggaatttacacttctcaaaggagaacacaggacaggtatcaccttccgggccgttccc
aatgggcatgaattcagttccctactgcttgccatcctgaatacggacggaaaaggaaag
aactttccggacgaaggcatctgcaaccgggtaaaatcattgaaaggacctgtccgcctg
acaacttacgtgtcactgacctgtaccaactgccccgacgtggtgcaggcactcaacgcc
atgaccacgctgaacggacagattcagcaccagactgtggacggagccatcaaccaggcg
gaagtagaggcactgaaaatacagggggttccttctgtcttcgcagacggtaaactgatc
cacgtggggcgtggtgactttggcgaactgttggccaaactggaagaacaatatggaacg
gagacgaacagtgcggaaacttccatcaaaaaatatgatgtgattgtagccggcggaggt
ccggccggttcggctgctgccatctattcggcccgtaaaggcttgaatgtagcggtcatt
gccgaacggatcggcggacaagtaaaagaaacagtaggcatagagaacctgatctccgta
ccttcgacaaccggaagccagttggccgataatctgaaaacccacatgtcacaatatccc
atcgatttgctcgaacatcgccagatcgaaaagatagagcttgatggaaaggataaggtt
ctgacagccaaaggaggagaacgtttctcagctccggcggtaatcgttgccaccggtgca
agctggcgcaaactgaacgtaccgggcgaagcggaatatatcggccgtggggtggctttc
tgtccacactgcgacggacctttctacaaagggaagcaggtggctgtcgtggggggagga
aattccggaatcgaagcagccatcgacctggcaggtatctgctccaaagttacggtgctc
gagtttatggacgagctgaaagcggatcaggttttacaggaaaaactgaaaagcctgccg
aatgtagaagttcttgttcactcgcagacaaccgaagtggtaggcaatggagataaggtg
accggcatccgtgtcaaagaccgcaaaacagaagaagaacgggtgatcagcctggatggc
atctttgtacagataggtttggtagccaatagtggtattttccgcgatgtggttgaggta
aatcgtccgggcgagatcgtgatcgatgcacattgccgtaccaacgtgccgggaatttat
gctgccggagacgtttccaccgtcccctacaaacagattatcatcgcaatgggagaaggc
gccaaagccgcattagccgcattcgaggatcggatgcgaggagaaatttaa

DBGET integrated database retrieval system