KEGG   Bacteroides fragilis NCTC9343: BF9343_1544Help
Entry
BF9343_1544       CDS       T00239                                 

Gene name
accC1
Definition
(GenBank) putative biotin carboxylase 1
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
bfs  Bacteroides fragilis NCTC9343
Pathway
bfs00061  Fatty acid biosynthesis
bfs00620  Pyruvate metabolism
bfs00640  Propanoate metabolism
bfs01100  Metabolic pathways
bfs01110  Biosynthesis of secondary metabolites
bfs01120  Microbial metabolism in diverse environments
bfs01130  Biosynthesis of antibiotics
bfs01200  Carbon metabolism
bfs01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bfs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BF9343_1544 (accC1)
   00640 Propanoate metabolism
    BF9343_1544 (accC1)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BF9343_1544 (accC1)
Enzymes [BR:bfs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     BF9343_1544 (accC1)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     BF9343_1544 (accC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 RimK
Motif
Other DBs
NCBI-ProteinID: CAH07325
GeneDB: BF1624
UniProt: Q5LEX4
LinkDB All DBs
Position
1896760..1898271
Genome map
AA seq 503 aa AA seqDB search
MIKKILVANRGEIAMRIFRTCRVMNIATVAIYTRVDRGALHVRYAEEAYCISDSPEDTSY
LKPEKILQIAKKTGAAIHPGYGFLSENADFARRCEEEGVIFIGPSADIIARMGIKTEARR
IMREAGLPIVPGTEDPMKGIAEAKKVAAEVGYPIMLKALAGGGGKGMRLVRSEEEMETAL
RLSQSEAGTSFGNDAVYIEKYIENPHHIEVQILGDKYGNVIHLYERECSIQRRNQKVIEE
SPSPFVKPETRAKMLKVAVEACKRINYYSAGTLEFMMDKDQNFYFLEMNTRLQVEHPVTE
ECTGVDLVRDMILVAAGNRLPYRQEDVEFRGAAIECRIYAEDPENNFMPSPGVITVREAP
EGRNVRLDSAAYAGFEVSLHYDPMIAKLCCWGRNRDSAISNMARALREYKILGIKTTIPF
HQRVLKNAAFLKGEYDTTFIDTRFDKEDLKRRQNTDPTVAVIAAALKHYEEEKEAASRAT
TLPVVGDSLWKYYGKLQMTANNY
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaagatattagttgcgaatcgtggcgaaatagccatgcgtattttccgtacc
tgccgggtaatgaatattgccacagtggctatctacacccgggtagatcggggtgccttg
catgtgcgttatgccgaagaggcttattgtatttccgattctccggaagatacgtcttat
ctgaaaccggaaaagattctgcaaatagccaaaaagacaggagctgccatccatccggga
tatggctttctgtctgagaatgcggacttcgcccgtcgttgtgaggaagaaggggtaatc
tttattggtccgagtgccgatattattgcccgaatgggtatcaagactgaggcccgccgg
attatgcgtgaagccggtttaccgatcgtaccgggcacggaagatccgatgaaaggcatt
gccgaagccaaaaaggtggctgccgaagtaggctatcccatcatgctgaaagcactggcc
gggggtggtggaaaaggtatgcgtctggtacgcagtgaagaagaaatggagacggcattg
cgcctttcacagtctgaagccggaacgtcgtttggcaacgatgctgtttatattgaaaaa
tatatcgagaatccccatcacatcgaagtacagatactgggagataaatatggaaatgta
attcatctttatgaacgggaatgttccattcagcgacgcaatcagaaagtaattgaagaa
tcgccttctccttttgtgaagcccgaaacacgtgccaagatgctgaaggttgcagtggag
gcctgtaagcggattaattattacagtgccggaacgctggagttcatgatggataaagac
cagaatttttattttctggaaatgaatactcgcctgcaggtggaacatccggtgacggaa
gagtgtaccggggtcgatctggtacgcgacatgatactggtagctgccggcaatcgtctg
ccttacaggcaagaagatgtcgagttccggggagctgccattgaatgtcgcatttatgcc
gaagatcccgagaataacttcatgccttcgcccggggtgataaccgttcgtgaagctccc
gaaggacgtaatgtccgtttggacagtgcggcttatgcgggatttgaggtttcgctgcat
tatgatccgatgattgcaaagctctgttgttggggacgtaatcgtgattcggctatttcg
aacatggcccgtgcgttgcgcgaatataagattctgggtatcaagactacgattcctttc
catcagcgtgtgttgaagaatgcggctttcctgaaaggagagtacgatactacctttatc
gatacgcgcttcgataaggaagacctgaaacgcaggcagaataccgatccgacagtagcg
gtgattgctgctgcgctgaaacattacgaagaagagaaagaggctgcttcacgcgccact
acgcttccggtagtaggagattcgctttggaaatattacggcaagttgcaaatgactgcc
aataactattaa

DBGET integrated database retrieval system