KEGG   Bacteroides fragilis NCTC9343: BF9343_1554Help
Entry
BF9343_1554       CDS       T00239                                 

Definition
(GenBank) putative dihydrolipoamide acetyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bfs  Bacteroides fragilis NCTC9343
Pathway
bfs00020  Citrate cycle (TCA cycle)
bfs00310  Lysine degradation
bfs00380  Tryptophan metabolism
bfs01100  Metabolic pathways
bfs01110  Biosynthesis of secondary metabolites
bfs01120  Microbial metabolism in diverse environments
bfs01130  Biosynthesis of antibiotics
bfs01200  Carbon metabolism
Module
bfs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bfs_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bfs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BF9343_1554
  09105 Amino acid metabolism
   00310 Lysine degradation
    BF9343_1554
   00380 Tryptophan metabolism
    BF9343_1554
Enzymes [BR:bfs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     BF9343_1554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding HlyD_3 GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: CAH07335
GeneDB: BF1635
UniProt: Q5LEW5
LinkDB All DBs
Position
1907410..1908777
Genome map
AA seq 455 aa AA seqDB search
MARFEIKMPKLGESITEGTILSWSVQVGDVVNEDDVLFEVNTAKVSAEIPSPVAGKVVEI
LFKEGDTVPVGTVVAIVDMDGEGSGEASETAGSVETASAPKAAEVSDTASVPKVQAEVAA
PKVERWYSPAVLQLAREAKISQEELDSIPGTGYEGRLSKKDIRTYIEMKKGAPAADVSTT
VVSTVLANNSGSSPVPSAEVQKKAAAAAPQAQHGQSASAVSSDASVEVKEMDRVRRIIAD
HMVMSKKVSPHVTNVVEVDVTRLVRWREKTKDAFFRREGVKLTYMPAIAEATAQALAAYP
QVNVSVDGYNILYKKHINVGIAVSQDDGNLIVPVVHDADRLNLNGLAVAIDSLAKKARVN
KLMPDDIDGGTFTITNFGTFKMLFGTPIINQPQVAILGVGVIEKKPAVVETPEGDVIAIR
HKMYLSLSYDHRVVDGSLGGNFLHFIADYLENWKE
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggcaagattcgaaataaaaatgcccaagttgggcgaaagtattaccgaaggaaccatt
ttatcatggtcggtgcaggtaggtgacgtggtcaatgaggacgacgtacttttcgaggtg
aatactgctaaggtcagtgcggagatcccttctcccgttgccggaaaagtggtggaaata
ttgtttaaagaaggcgatacggtaccggtaggtacggtagttgccattgtagatatggat
ggagaaggttccggagaagcatcggaaaccgcaggctctgtagaaacggcgtctgctcca
aaggctgccgaggtgtcggacactgcgtctgttccgaaagttcaggcggaagtagccgct
cccaaagtggaacgttggtattcgccggcagtacttcaattggcacgggaggcgaagatt
tctcaggaagaactggattcgattcccgggacaggttatgaaggccggctgagcaaaaaa
gatatccgcacttacatcgagatgaagaaaggtgctccggcagccgacgtctctactacg
gtggtttcgacggttttggcaaataattcgggctcttctcctgttccttctgcagaagta
caaaagaaggctgccgctgcggctcctcaggctcagcatggacaatctgcttctgccgtt
tcttcagatgcatcggtagaagtcaaggagatggatcgagtacgtcgcatcattgccgac
catatggtgatgtcgaaaaaggtttctccgcatgtgactaatgtggtcgaagtagatgtc
acccggctggtgcgttggcgcgaaaagaccaaagatgctttcttccgtcgtgaaggtgtg
aagctgacttatatgcctgccattgctgaggccactgcccaggcgttggctgcctatcct
caggtaaatgtctcggtggacggatacaacatcctgtataagaaacatatcaatgtgggc
attgctgtttcgcaagatgatggaaacttgattgttcccgtagtgcatgatgccgatcgt
ttgaatcttaacggacttgccgtagctatcgattcgttggcgaaaaaggcacgggttaat
aagctgatgcctgatgatatcgacggaggaacatttacaatcaccaatttcggtacgttt
aagatgttgttcggaactccgatcatcaatcagccgcaggtggctattctcggagtgggt
gtcattgagaaaaagccggctgtggtggagactcccgaaggagatgtgatagccattcgc
cataagatgtacttgtcactctcttatgatcaccgtgtggtggatggttcgctgggaggt
aacttcctgcacttcattgccgattatctggagaactggaaagaatag

DBGET integrated database retrieval system