KEGG   Bacteroides fragilis NCTC9343: BF9343_2471Help
Entry
BF9343_2471       CDS       T00239                                 

Definition
(GenBank) putative hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
bfs  Bacteroides fragilis NCTC9343
Pathway
bfs00010  Glycolysis / Gluconeogenesis
bfs00051  Fructose and mannose metabolism
bfs00052  Galactose metabolism
bfs00500  Starch and sucrose metabolism
bfs00520  Amino sugar and nucleotide sugar metabolism
bfs00521  Streptomycin biosynthesis
bfs00524  Neomycin, kanamycin and gentamicin biosynthesis
bfs01100  Metabolic pathways
bfs01110  Biosynthesis of secondary metabolites
bfs01120  Microbial metabolism in diverse environments
bfs01130  Biosynthesis of antibiotics
bfs01200  Carbon metabolism
Module
bfs_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bfs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF9343_2471
   00051 Fructose and mannose metabolism
    BF9343_2471
   00052 Galactose metabolism
    BF9343_2471
   00500 Starch and sucrose metabolism
    BF9343_2471
   00520 Amino sugar and nucleotide sugar metabolism
    BF9343_2471
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BF9343_2471
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BF9343_2471
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bfs04131]
    BF9343_2471
Enzymes [BR:bfs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     BF9343_2471
Membrane trafficking [BR:bfs04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    BF9343_2471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexokinase_1 Hexokinase_2 Phage_holin_3_1
Motif
Other DBs
NCBI-ProteinID: CAH08252
GeneDB: BF2552
UniProt: Q5LCB3
LinkDB All DBs
Position
complement(2976105..2977313)
Genome map
AA seq 402 aa AA seqDB search
MEKNIFKLDNEQLKGIAHAFREKVEEGLNKNNAEIQCIPTFILPKATDVKGKALVLDLGG
TNYRVAIVDFSTEKPIIYPNNGWKKDMSIMKSPGYTREELFKELADLIVEIKREEEMPIG
YCFSYPTESIPGGDARLLRWTKGVDIREMVGQFVGKPLLDYLNEKNKIRFTGVKVLNDTI
ASLFAGLTDKSYDAYIGLIVGTGTNMATFIPSDKITKLDPECHVQGLIPVNLESGNFYPP
FLTAVDDTVDATSDSLGKQRFEKAVSGMYLGDILKAAFPLEEFEEKFDARKLTAMMNYPD
IHKDIYVQVAHWIYNRSAQLVAASLAGLIALLKSYNRDIHRVCLIAEGSLFWSESRKDKN
YNILVMEKLQELLRELELEDVEVHINSMDNANLIGTGIAALS
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggagaagaatattttcaaactggacaatgaacaactgaaaggaatcgcgcacgcattc
cgggagaaagtggaagagggattaaataagaataatgctgaaatacaatgtattcctacc
tttattttacctaaggcgaccgatgttaaaggcaaggctttggttctggacctgggaggt
accaactatagagtggcaattgtcgatttctcaaccgaaaagccaatcatctatcccaat
aatggttggaagaaggatatgtcgattatgaagtcgcccggttatacccgtgaagagttg
ttcaaagagttggccgacctgattgttgaaataaagcgggaagaggaaatgcctatcggt
tattgtttttcttatccgaccgaatcgataccgggaggcgatgcaagattgcttcgttgg
accaagggggtagacattcgggaaatggtgggacagtttgttgggaaacccttactcgac
tacctgaatgaaaaaaataaaatcagatttacaggagttaaagtgctgaatgacacgatt
gccagtttatttgccgggcttaccgacaaaagctatgatgcttatattggcctgattgta
gggacaggtacaaatatggcaacttttattccgtctgacaagataacgaagttggacccg
gaatgtcacgtacaaggcttgattccggtcaatctggaatcgggaaacttttatcctccc
ttcctgactgcggtggacgatactgttgacgcaacttctgacagtttgggtaaacagcgt
tttgagaaagcggtatccggcatgtatctgggggatatcctgaaagcagctttccctttg
gaagaatttgaagagaaatttgatgcaaggaaactgactgctatgatgaattatcctgat
atacacaaagatatctatgttcaggtagcccattggatctataacagatcggcccagctc
gtcgctgcctctcttgccggattaatcgcattgctgaaatcgtataatcgagatatccat
cgggtttgtctgattgccgagggcagtcttttctggagtgaaagtcggaaagataaaaac
tataatatccttgtaatggagaaattgcaggaacttcttcgtgagcttgaactggaagat
gtcgaagttcatattaatagtatggataatgccaatctgataggaacggggattgcggca
ttatcctga

DBGET integrated database retrieval system