KEGG   Bacteroides fragilis NCTC9343: BF9343_2475Help
Entry
BF9343_2475       CDS       T00239                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase [Fe]
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bfs  Bacteroides fragilis NCTC9343
Brite
Enzymes [BR:bfs01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BF9343_2475 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CAH08256
GeneDB: BF2556
UniProt: Q5LCA9
LinkDB All DBs
Position
2982352..2982933
Genome map
AA seq 193 aa AA seqDB search
MTYEMPKLPYANNALEPVISQQTIDYHYGKHLQTYVNNLNSLVPGTEYEGKTVEAIVASA
PDGAIFNNAGQVLNHTLYFLQFAPKPAKNEPAGKLGEAIKRDFGSFENFKKEFNAASVGL
FGSGWAWLSVDKDGKLHITKEPNGSNPVRAGLKPLLGFDVWEHAYYLDYQNRRADHVNKL
WEIIDWDVVEKRL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgacttacgaaatgcctaaacttccgtacgcaaacaatgcgctggaacctgtaatcagt
cagcaaaccatcgattaccattatggtaaacatcttcaaacatatgtaaacaatctcaat
agcctggttccgggcaccgaatatgaaggaaaaacagtagaagccatcgtagcctcggct
cccgacggagctatcttcaataatgccggacaggtgctgaaccatactctgtacttcctg
caatttgcgccgaaaccggcaaagaacgaaccggcaggcaagttgggagaagccatcaaa
cgcgacttcggcagctttgaaaacttcaagaaagagttcaacgcagcttctgtaggattg
ttcggttcgggatgggcctggctgtccgttgacaaagacggaaagctgcacatcaccaaa
gagcccaacggaagcaatccggtacgcgcgggactgaaaccgttactgggatttgacgta
tgggaacatgcttactacctcgactatcagaaccgtcgtgccgaccacgtaaacaaactg
tgggagatcatcgactgggatgtcgtagaaaaacggctgtaa

DBGET integrated database retrieval system