KEGG   Botrytis cinerea: BCIN_02g00870Help
Entry
BCIN_02g00870     CDS       T01072                                 

Gene name
Bcgst8
Definition
(RefSeq) Bcgst8
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bfu  Botrytis cinerea
Pathway
bfu00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bfu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BCIN_02g00870 (Bcgst8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bfu02000]
    BCIN_02g00870 (Bcgst8)
Enzymes [BR:bfu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BCIN_02g00870 (Bcgst8)
Transporters [BR:bfu02000]
 Other Transporters
  Pores ion channels [TC:1]
   BCIN_02g00870 (Bcgst8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C Glutaredoxin GST_N_4
Motif
Other DBs
NCBI-GeneID: 5436491
NCBI-ProteinID: XP_001555922
UniProt: A0A384J860
LinkDB All DBs
Position
2:complement(join(390658..391353,391410..391520))
Genome map
AA seq 268 aa AA seqDB search
MSAVHPDANLFPHATGLAAEMVKQYSKEEPVKLYAGWFCPFTQRVLLLLLEKRIPFQYIE
VNPYQKPLSLLKLNPRGLIPTLSYEGKALYESTIICEFLEDAYPSHYPRLLTREPFERAR
LKIWTDHITSRVVPAFNRFLQYQSVSLKDPRVLAIRNKFLTSLYEFTQEMHPIGPYFTGK
EPCIVDYVLAPWALRIWIFDYFKGGLHIEELGELTGRWKKWLEAIEKRKSIQMTLSATEY
YLPIYERYADSVPYVKIEKSREEEDGVF
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgtacatccagatgcaaatctctttccacatgccaccggcttggctgccgag
atggtaaaacaatattctaaggaagagccggtgaagctctatgctggatggttctgtccc
ttcacccaacgcgtacttctcctcctcctcgaaaaacgcatccccttccaatacatcgaa
gtaaacccataccaaaaacccctatccctcctcaagctcaatccccgcggtctcatcccc
accctctcctacgaaggcaaagccctctacgaaagcacaatcatatgcgagtttctcgaa
gacgcatacccatctcactacccccgattactcactcgcgaaccattcgagagagcccga
ttgaagatttggaccgatcacatcacatcacgtgttgtaccggcctttaatcgctttctt
cagtatcaatcagtttcattgaaggatcctagggttttggcgattcgtaataagtttctt
acgtcactctatgagtttacgcaggaaatgcatcctattggaccttatttcacaggcaaa
gaaccgtgtatagtagattatgttctagcgccctgggcacttcgtatctggatctttgat
tatttcaaaggcggtttgcatattgaagaattgggagaattgacaggaagatggaagaag
tggttggaggctattgagaagagaaagagtattcaaatgactttgagtgcgacggaatac
tatttacctatttatgagagatacgcggatagtgttccgtatgtcaagattgagaaatcg
agggaagaggaagatggagtgttttag

DBGET integrated database retrieval system