KEGG   Botrytis cinerea: BCIN_02g06040Help
Entry
BCIN_02g06040     CDS       T01072                                 

Definition
(RefSeq) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
bfu  Botrytis cinerea
Pathway
bfu03030  DNA replication
bfu03410  Base excision repair
bfu03420  Nucleotide excision repair
bfu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bfu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    BCIN_02g06040
   03410 Base excision repair
    BCIN_02g06040
   03420 Nucleotide excision repair
    BCIN_02g06040
   03430 Mismatch repair
    BCIN_02g06040
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bfu03032]
    BCIN_02g06040
   03400 DNA repair and recombination proteins [BR:bfu03400]
    BCIN_02g06040
Enzymes [BR:bfu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BCIN_02g06040
    6.5.1.6  DNA ligase (ATP or NAD+)
     BCIN_02g06040
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     BCIN_02g06040
DNA replication proteins [BR:bfu03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    BCIN_02g06040
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     BCIN_02g06040
DNA repair and recombination proteins [BR:bfu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     BCIN_02g06040
   NER (nucleotide excision repair)
    Other NER factors
     BCIN_02g06040
   MMR (mismatch excision repair)
    Other MMR factors
     BCIN_02g06040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 5427043
NCBI-ProteinID: XP_001546584
UniProt: A0A384JA34
LinkDB All DBs
Position
2:complement(join(2134328..2135908,2135998..2136360,2136468..2137130))
Genome map
AA seq 868 aa AA seqDB search
MGTPTKRRKLNNDTKSSGSRNLDFFFGKQKKDEEGLSSRQAGSPILSSPGSAGPSELTDE
QLARKLQEEWNRESIGAGEVAENHSVKIDEKLAEAPIPAVATTSHTYEGTSINGIHDQLN
IKPPRPNTNKNTLSLQSAGTAEDNISSSIPLDESPLTFEPSKYVFDLQKHWAAEGGDASY
ALLTRCFVLVNSTQSRIKIVDTLVNLLRIIIEGDPDALLPTVWLATNAISPPYISLELGL
GGSAISKALKNVCGLDSKSLKTLYNKHGDAGDVAFEAKKRQSFTLRKPKPLTIKGVYQSL
VKIAKTQGTGSSEIKQRVVDRLLQDARGAEESRYVVRTLCQHLRIGAVKTTMLIALSRAF
QLSKPPGADFPLKSPQELAKLKKEGLTEVWSKGEEIVKACFAKRPNYNDLVPVLLEIGVC
EELLIRCGLALHIPLRPMLGSITRDLAEMLTKLQGRDFSCEYKYDGQRAQVHCDENGKVS
IFSRHLELMTDKYPDLVALIPKIRGEGVDSFIMEGEVVSVDRETGDLKPFQSLANRARKD
VAIGSVTINVCLFSFDLMYLNGESLLNRTFRERRELLRGLFVEVPNQFTWVKSIDATSQD
SEVVLEFFKGATERKCEGIMVKILDNLPHATLPESEESSDEPMTSVLQTSQKQSKGKRKP
TDKEPEKKTRRKALLSTYEPDKRLDSWLKVKKDYSASYDTLDLIPVAAWHGQGRKAKFWS
PILLAVRNEETGTLEAVCKCISGFSDTFYKANKEFYEEGGEHVLGGKPNYVDYRGGNPDV
WFEPQEVWEMAYADVTISPVYRAAIGLVSDEKGLSLRFPRFLKKREDKSIEEASTNEFLA
SLWRKQEQKVDGGKNEAQGVDSEEEEEE
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atggggacgcctacgaagcggcggaagctcaacaatgatacaaagtcaagtggttctcga
aatctcgacttctttttcggaaagcaaaagaaagatgaagaagggctgtcgtctcgacaa
gccggcagtccgatcctgagcagtccaggtagcgcgggtccctcggaattgactgatgag
caactggctagaaaattacaagaggaatggaaccgggaatcaattggcgcaggagaggtg
gccgagaatcattcggtgaagatcgatgagaaacttgcagaggctccaatccctgcggta
gctacgacaagccatacatacgaaggaacctcgattaatggcatacacgaccagctaaac
ataaaaccacccaggccaaataccaataagaatactctttcactacaatccgctggcaca
gcagaagataacatttcatcaagcataccattggatgaaagtcctttgactttcgaacct
tcgaaatatgtgtttgacctgcaaaaacactgggctgcagaaggaggggatgcgtcttat
gctctcctgacaagatgttttgtactcgtgaatagcactcagagccgtataaaaattgta
gatactttagtcaatttactaaggatcatcatcgagggtgacccggatgctctcctaccc
actgtctggctggcaacgaatgcgatttcaccgccatacatatcccttgaactaggattg
ggaggctcagccatttcaaaagcactgaaaaatgtgtgtgggctggactctaagtcattg
aagaccttgtacaacaaacacggtgatgctggcgatgttgcttttgaggctaagaagagg
caaagctttacattgagaaagccaaaaccactcacaataaaaggagtttatcaatcctta
gtcaaaatagccaagacacaaggaacaggcagtagcgagatcaaacaacgagttgttgat
cgtttattgcaagatgctagaggagcagaggagagtcgatatgttgttagaactttgtgc
caacatcttcgtatcggtgcagtgaaaactacaatgttgattgccttatctcgagctttc
caactatccaaacctccgggggcagactttcctcttaaatcaccacaagagctggcaaaa
cttaaaaaagaaggtttgactgaggtgtggtccaagggcgaggaaatcgtgaaagcatgt
tttgcaaagagacccaattataacgacctagtacccgttttacttgagattggagtctgc
gaggaactactaattagatgcggactagccttacatattcccttacgacctatgttagga
agtatcactagggatcttgcagaaatgcttacgaaacttcaaggtagagatttcagttgt
gaatacaagtatgatggacaacgagcacaagttcattgcgatgagaacggcaaagtgtca
atattctcaaggcatttagaactcatgactgataaatatcctgatcttgtggcattaata
cccaagattcgcggagaaggagttgacagtttcatcatggaaggagaggtcgtttctgtc
gatcgggaaactggtgatctgaaaccctttcaatcattagcaaatcgagcgaggaaagac
gtggcaattggaagtgttactattaatgtgtgcctgttctctttcgatttgatgtatcta
aatggagaatcacttcttaatcgaacattccgggaaaggcgagaacttcttcggggcttg
ttcgtcgaggtaccgaatcagttcacctgggtgaagagtatcgatgctacttctcaagac
tcagaggttgtcttggaattcttcaaaggtgcgacagagcgaaagtgcgaaggaatcatg
gtgaagattctagataatctaccacacgctacgctacctgagtccgaggaatcttcagat
gagccaatgacctctgttctccagacgtcccagaaacaatcaaaagggaagaggaagcct
acagacaaagagcccgagaagaaaactcgaagaaaagctttattatctacctatgagcct
gacaaacgactggattcttggctgaaagtaaagaaagactacagtgcttcatatgataca
ctcgatctgatacctgttgctgcttggcatggccaaggacgcaaagcaaagttttggtca
ccaattctcctcgcggttcgcaacgaagagacgggcactctggaagccgtgtgtaagtgt
atatctggatttagtgatacgttttacaaggccaacaaagaattttacgaagaagggggc
gagcatgttcttgggggcaaaccgaattacgtcgattatcgaggaggaaaccccgatgta
tggtttgaaccgcaagaggtctgggaaatggcttatgccgatgtcacaattagtccagtg
tatagagcggcaattggtcttgtgagcgatgaaaagggattaagtttgagatttcctaga
ttcttaaaaaagagagaagacaaatctatagaagaggctagcacaaacgaatttctggct
agcttgtggaggaagcaggaacagaaggttgacggtggaaagaatgaagcacagggagta
gattcggaggaggaggaggaggagtaa

DBGET integrated database retrieval system