KEGG   Botrytis cinerea: BCIN_02g09190Help
Entry
BCIN_02g09190     CDS       T01072                                 

Definition
(RefSeq) hypothetical protein
Organism
bfu  Botrytis cinerea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 5434891
NCBI-ProteinID: XP_024547406
LinkDB All DBs
Position
2:join(3256975..3257079,3257342..3257629,3257721..3257765,3257854..3258978)
Genome map
AA seq 520 aa AA seqDB search
MSSNLTEAALPLRDDTVSTGPDAPNPLNRADEVEDLLNAVQSLIIPFIRSADEDATTKHT
GHGKAIPGGGPRTTLLEHHKPEKLLQLLDFNLPINGRGKHGLLSTIEQVLKYSVNTWDQG
FLDKLYASTNAVGIISELILAVLNTNVHVYQVSPALTIIEKTTAKSFANLFGFNGPHAGG
ISTQGGSASNTTSMIIARNTLFPDTKQNGNGNHQFVLFTSAHGHYSLEKAAQMCGLGSNN
VIPVPVDSQGRMIPSELDSLIQKSISENKTPFYVNATAGTTIYGSYDPFTEISAICKAHN
LWLHIDASWGGPAIFSPTHASKLKGSHLADSLAVNPHKMLNAPVTCSFLLAPDLTKFHKA
NTLPADYLFHTIEDGAEVWDLADLTLQCGRRGDSLKLALSWIYYGTSGFQQQIDHAFSVA
GYFAQLVNEHKDFVLVSENPPPCLQVCFYYAKDGKLGGKEQNTKITQDVAQKLLTRGFMV
DYASGEKGKFFRAVVNVQTRRETMEGLVKAIVEIGEGVVV
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcaaacctaacagaggccgccttaccactccgggacgacacggtttcaactggg
ccagatgctccaaacccattaaaccgtgccgacgaagtagaagatttactcaatgccgtg
cagtctctcatcatcccattcatcagatcggccgatgaagatgccaccaccaagcatacc
ggtcacggaaaagccattcccggtggaggtcctcgaaccactcttctcgaacatcacaaa
ccagagaagctactccagctgctagatttcaatctccccatcaatggaagaggaaaacat
ggtttgttatcaaccatcgagcaagtgctcaaatacagtgtgaatacgtgggaccaagga
ttcttagacaaactgtatgcaagcaccaacgcggtaggaattatctcggaattgattttg
gccgttttaaatacaaatgttcatgtataccaagtttccccagccctgaccattattgaa
aaaaccacggcaaaatcgtttgccaatcttttcggtttcaatggccctcacgccggtggt
atctccactcaaggtggctcggcttcaaacacaacctccatgatcattgcccgcaatact
cttttcccagacaccaaacaaaatggaaatggaaaccatcaattcgttctcttcacttcg
gcccatggccactattcgctggaaaaagctgctcagatgtgtggcctcggatccaacaac
gtgattcccgtccccgttgattcgcaaggtcgcatgatcccctcggaactcgactccctc
atccaaaagagcatatccgaaaacaaaactcccttttacgtaaatgccaccgccggaacc
accatctatggttcctacgacccctttaccgaaatctccgccatctgtaaagcccacaat
ctctggttacacatcgatgcttcgtggggtggtcccgccatcttctctcccacccacgcc
tccaaattaaaaggatctcacctcgccgattccctggccgtaaacccgcacaaaatgtta
aatgcccccgtaacctgttccttcctgctcgcacccgacctcacaaaattccacaaagca
aacaccctacccgcagactacctcttccacaccatcgaagacggagccgaagtctgggat
ctcgccgatctcacattgcaatgcggtcgtcgtggggattccctcaaattagctctatcc
tggatctactacggtacatcaggcttccagcaacaaatcgaccatgcattttccgtggcg
ggatattttgctcaattagtcaacgagcacaaggacttcgtacttgtttctgaaaatcct
ccgccctgtctacaggtgtgtttctactatgccaaggatgggaaactaggaggaaaagaa
cagaataccaaaatcacgcaggatgtcgcgcagaaattgttgacgagaggatttatggtg
gattatgcgagtggggaaaaggggaaattcttcagagccgtcgtcaatgtacagacgaga
cgggaaacgatggagggtttggtgaaagcgattgtggagattggagagggtgttgtggtg
tag

DBGET integrated database retrieval system