KEGG   Botrytis cinerea: BCIN_03g01040Help
Entry
BCIN_03g01040     CDS       T01072                                 

Definition
(RefSeq) hypothetical protein
Organism
bfu  Botrytis cinerea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 OKR_DC_1 MTCP1
Motif
Other DBs
NCBI-GeneID: 5440057
NCBI-ProteinID: XP_024547490
LinkDB All DBs
Position
3:join(366879..367064,367149..367232,367392..367443,367503..368067,368119..368782)
Genome map
AA seq 516 aa AA seqDB search
MVHLSQIPNNDKVAAPLVDGLKKLTMAASSEEDRFTTSVYGSRFAAEDLPEHEMPDGEMP
KEVAYRMIKDHLSLDGNPMLNLASFVTTFMEKEVEDLMTESFSKNFIDYEEYPQSADIQN
RCVSMIGRLFNAPTNEEGDAAVGTSTVGSSEAIMLAVLAMKKRWKNARIAAGKSTENPNI
VMSSAVQVCWEKAARYFEVEEKYVYCTPDRYVIDPEETVNLVDENTIGICIILGTTYTGE
YEDAKAVNDLLIKKNIDTVIHIDAASGGFVAPFTVPELEWDFRLEKVVSINTSGHKYGLV
YPGVGWIVWRAPEYLPKELVFNINYLGADQASFTLNFSKGASQVIAQYYQLIRLGKKGYK
AIMSNLTRTADYLSDSLEQLGFIIMSQKNGNGLPLVAFRIDPNSNKHYDEFALAHQLRQR
SWVVPAYTMAPKTDNLKMLRVVVREDFSKSRCDSLLNDIKLCCSVLDEMDKDSVKKNQEY
IQKHATHSGKSKHNHAHYKDEKHSLQGKTGKTHAIC
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggttcacctttcccaaatccccaacaatgataaggttgcggctcccctcgtcgacggg
ctgaagaaacttacaatggctgcttcgagcgaagaggatcgattcacaactagtgtttat
ggttctagatttgcagcggaggatctgccagagcacgagatgccagatggagagatgccc
aaggaggttgcgtatcgtatgatcaaagatcatctttcgcttgatggaaatcctatgttg
aatttggcgtcttttgtcactactttcatggaaaaagaagtcgaagatctcatgaccgaa
agtttcagcaagaatttcattgattacgaagaatatcctcaatccgcagacattcaaaac
cgatgtgtttccatgatcggtcgtttgttcaacgctcctacaaatgaagaaggtgatgct
gccgttggtacttcgaccgtcggttcctccgaagccatcatgttggcagttttggccatg
aagaaacgctggaagaatgctcgtatcgctgctggaaaatcaactgaaaacccaaatatc
gtcatgtcttctgcggttcaagtctgctgggaaaaggcagctagatatttcgaggttgag
gaaaaatacgtctattgtactccagaccgatatgtgattgaccccgaggagacggtcaat
ttagtagatgagaataccattggtatttgcatcattctaggaactacttatactggagag
tatgaagatgccaaggctgtgaatgatcttttgatcaagaagaatatcgatactgttatt
catattgatgcagcttcaggtggatttgtagctccctttaccgtaccagagttggagtgg
gatttcagattagaaaaggtagtttctattaacaccagtggtcacaaatatggactcgtc
tacccaggtgttggttggattgtctggagagcaccagaataccttcctaaggagcttgtc
ttcaacatcaattatcttggtgccgatcaagcatctttcactcttaacttttccaagggt
gcttctcaggttattgcccaatactaccaactcattcgtcttggtaagaagggttacaaa
gctatcatgagtaacttgacaagaaccgccgattacctctccgattctctcgaacaactc
ggattcattatcatgtctcaaaagaatggcaacggtctcccactcgttgctttccgtatt
gaccctaactccaacaaacattacgatgaattcgcacttgctcatcaactccgtcaacgt
tcatgggttgttccagcatacaccatggcaccaaagaccgataacctcaagatgttacgt
gtagttgttcgtgaggatttcagtaaatcaagatgtgattcattgttgaatgacatcaag
ttatgctgcagtgtcctggatgagatggataaggattctgttaagaagaatcaagaatac
atccagaagcacgctactcactctggaaagagcaagcataaccatgctcattataaggac
gagaagcatagtttgcaaggaaagactggaaagactcatgctatttgttaa

DBGET integrated database retrieval system