KEGG   Botrytis cinerea: BCIN_03g03390Help
Entry
BCIN_03g03390     CDS       T01072                                 

Gene name
Bcsod1
Definition
(RefSeq) Bcsod1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
bfu  Botrytis cinerea
Pathway
bfu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:bfu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    BCIN_03g03390 (Bcsod1)
Enzymes [BR:bfu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BCIN_03g03390 (Bcsod1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 5441162
NCBI-ProteinID: XP_001560530
UniProt: A0A384JBV7
LinkDB All DBs
Position
3:complement(join(1134542..1134564,1134623..1134719,1134770..1134921,1134990..1135169,1135434..1135446))
Genome map
AA seq 154 aa AA seqDB search
MVKAVATVRGDSKISGTVTFEQSEENSPTTITWNITGNDANAERGMHVHQFGDNTNGCTS
AGPHFNPHGQTHGAPTDEVRHVGDLGNFKTDAQGNATGSVQDSHIKLIGPLSVIGRTVVV
HSGTDDLGKGENEESKKTGNAGTRPACGVIGIAA
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggttaaagcagttgctaccgtccgcggtgactccaagatctccggcaccgtcactttc
gagcaatccgaggagaactccccaaccaccatcacatggaacatcaccggaaacgatgcc
aatgctgagcgtggcatgcacgtccatcaattcggtgacaacactaacggctgcacatct
gccggaccacatttcaacccacacggccagacccacggtgctcccaccgatgaggttcgc
catgtaggtgatcttggaaacttcaagactgatgcccaaggaaatgctactggctctgtt
caagacagtcacattaagttgatcggcccattgagcgtcattggccgtaccgttgttgtc
cactccggaactgatgatctcggtaagggagagaacgaagagtccaagaagaccggtaac
gctggaaccagaccagcttgtggtgttatcggtattgctgcataa

DBGET integrated database retrieval system