KEGG   Botrytis cinerea: BCIN_04g04190Help
Entry
BCIN_04g04190     CDS       T01072                                 

Definition
(RefSeq) hypothetical protein
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
bfu  Botrytis cinerea
Pathway
bfu00500  Starch and sucrose metabolism
bfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BCIN_04g04190
Enzymes [BR:bfu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BCIN_04g04190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 5438146
NCBI-ProteinID: XP_024548362
LinkDB All DBs
Position
4:join(1491916..1492243,1492296..1492508,1492563..1492718,1492802..1492940,1492994..1494176)
Genome map
AA seq 672 aa AA seqDB search
MASSLLSSLSSISTFNSTQILQAVQPIMHTFAPLLLVGSLALQTIYALPGPSKVEQRAEI
LKRSVDSFIATESPIAFRNLLCNIGADGACASGAASGIVVASPDKVSPDYFYTWTRDSAL
VFKALVDTFISSSYSASLQQEIENYISSQAGLQTVSNPSGGLSSGGLGEPKFNADKSAFT
GSWGRPQRDGPALRATAMITYSKWLIANGYTSTVQTIVWPIIRNDLSYVTQYWNQTGFDL
WEEVQGSSFFTVAAQHRALVEGSALAAQIGQSCTYCDSQAPQVLCFLQSFWSSSSGYIIS
NINQNSGRNGKDANSILSSIQTFDPTAACDATTFQPCSDRALANHKVVTDSFRSIYSINS
GIAEGVAVSVGRYPEDSYYGGNPWYLNTLAAAEQLYDALYTWNRIGSITVTSTSLAFFKD
FSSSITAGTYASSTSTYTTLYNAIKTYADGYVNVVATYAQANGSLSEQFNKAGGAPLSAY
DLTWSYAAFLTAAARRAGVVPYSWGEPSASSVPGTCSATSAIGTYSTATATSWPASQTPS
GGGGSTPTTSTSATTKTTSTSTTTSSCATATSVAVTFNELVTTSFGQTIKLAGSVSQLGS
WAPASAIALSAAKYTASNPLWTVTVNLPAGTTVLYKFINVASDGTVTWQADPNKSYTVPV
GCATTATVSGSW
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttctctgctttcctccctcagctccatcagcactttcaacagcactcagatc
ctccaagctgttcaacctattatgcatacattcgctcccctccttttggttggcagtctt
gccctccaaactatctatgctttgcctggccccagtaaagttgagcaacgcgccgaaatc
ctaaaacgctcagtggattcttttattgccaccgaaagtcctattgctttcagaaatctt
ttatgcaatatcggcgcagatggagcttgtgcttcaggggcagcttcgggtattgtggtt
gcttcgcctgacaaagtgagcccagattatttttatacttggactcgagactccgcattg
gtattcaaagcccttgttgatacgtttatcagcagcagctattctgcatcacttcaacag
gaaattgaaaattacatcagctcccaagctggacttcaaaccgtgtcaaacccttcaggt
ggtttatcatccggtggtctgggcgagcccaaatttaatgcggataagtcggcattcaca
gggtcttggggaagacctcaacgagatggacccgctttacgtgctactgctatgattacc
tattcaaaatggttgattgccaacggatacacctccactgtgcaaactattgtttggccg
atcatcagaaatgatctgtcttatgttactcaatattggaaccaaactggctttgatctc
tgggaagaggttcaaggctcaagtttcttcacagtcgctgctcaacatcgtgctcttgtt
gaaggtagtgcactggccgctcaaattggtcaaagctgtacctattgtgattctcaagcc
ccacaggttctttgtttcctccaaagcttctggagttcatcctcgggatacatcatttcc
aacatcaaccaaaacagcggaagaaacggaaaagatgcaaacagtatcttgagttctatc
cagacctttgatcctaccgctgcatgtgatgccaccacgttccaaccatgctcagaccgt
gctttggcaaatcacaaagttgtgactgattctttcagatctatctacagcatcaactct
gggattgccgaaggtgtcgccgtttctgttggacgctacccagaagattcttactatggt
ggcaatccttggtatctcaatacccttgctgctgccgaacagctttatgatgctttatac
acctggaatagaattggctctatcaccgtaacttccacttccctagcattcttcaaagat
ttcagctcttccatcacagccggaacatacgcatcctccacatcaacctacaccactctc
tacaacgccatcaaaacctatgccgacggctacgtcaatgtcgtcgcaacctacgcacaa
gccaacggttccctctcagaacaattcaacaaagccggcggcgctcccctctcagcctac
gacctcacctggtcctatgctgccttcctcaccgccgctgcccgtcgcgcaggtgtcgtc
ccatactcatggggtgagccatccgcctccagcgtcccaggaacctgttctgctacctcg
gccatcggaacctattctaccgcaaccgccacttcctggcccgcatcgcaaacccccagc
ggaggaggaggaagtacccccacaaccagcacatccgccaccaccaagacaacttccacc
tcgaccaccacttcttcatgcgcaacagccacttcagtagctgttactttcaatgaattg
gtcactacctcctttggccaaacgatcaaactcgctggttccgtctctcaattgggaagt
tgggcaccggcttctgcgattgcattgagcgccgcgaagtacaccgctagtaatccgttg
tggaccgtgactgttaacctaccagctggcacgacggtattgtataagtttattaacgtg
gcgagtgatgggacggttacctggcaggcggatccaaataagagttatactgttccggta
ggctgtgctacgactgctactgttagtggtagctggtaa

DBGET integrated database retrieval system