KEGG   Botrytis cinerea: BCIN_05g01030Help
Entry
BCIN_05g01030     CDS       T01072                                 

Definition
(RefSeq) hypothetical protein
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
bfu  Botrytis cinerea
Pathway
bfu00040  Pentose and glucuronate interconversions
bfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BCIN_05g01030
Enzymes [BR:bfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     BCIN_05g01030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C PALP Met_10 AdoHcyase_NAD HI0933_like
Motif
Other DBs
NCBI-GeneID: 5432604
NCBI-ProteinID: XP_001552084
UniProt: A0A384JGL4
LinkDB All DBs
Position
5:join(405472..405495,405562..406614)
Genome map
AA seq 358 aa AA seqDB search
MADISGKSNKSFVLEKPFSVKFEERPVPKLESEHDVLIAINYTGICGSDVHYWVEGAIGS
YVVKDPMILGHESAGTIVSVGSAVKSLKVGDRIALEPGYPCRRCPSCLSGHYNLCPEMHF
AATPPIDGTLTGFYSSPADFCYKLPEHVSLQEGALLEPLAVAVHICKQAVITPGQSVVVM
GAGPVGLLCMAVARAYGASIIVAADIQPSRLEFAKSFAATHTFTPQRVSAAENAATLKSE
IGLPDGADVVIDASGAEPSIQTSINVVRRGGTYVQGGMGKADINFPIMELCTKEITAKGS
FRYGSGDYTLALQLVSTGKVDVKKLITGEVQFEDAEQAFKSVKEGKGIKVLIKGPNEN
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggcagatatatcaggaaaaagcaacaagtcattcgttctcgaaaagcctttctctgtt
aaatttgaggagaggccagttcccaaactcgaatctgaacacgatgttctcattgccata
aactatactggtatctgcggatccgatgttcattattgggttgaaggagcaatcggttcc
tacgttgtgaaagatcctatgattcttggccacgaatccgctggtacaattgttagcgtc
ggttcggcagtcaaaagtctgaaggttggcgatcgtattgctctcgaacctggttatcca
tgtcgtcgttgtccatcttgtctttcgggtcattataacctgtgtcccgaaatgcatttt
gcggccacccctcctatcgatggtactcttacaggattttattcttctccagcagatttc
tgttataaactcccagagcatgtatcgcttcaagaaggtgctctacttgagcctcttgct
gtagcagtccatatttgcaagcaagctgtgattaccccaggacaatctgtcgtggtaatg
ggagcaggtcccgttggtctattatgtatggcagtggctcgtgcatacggagcatctatc
atcgtcgcagcagatatccaacctagccgtctcgaattcgcgaaatcttttgccgctacc
cacacctttactcctcaacgtgtctccgccgcagagaacgctgcaactctgaaatctgaa
atcggacttccagatggcgcagatgtggttatagatgccagtggagcagaaccctccatt
caaacctctataaatgtcgtacgtcgcggaggaacatatgttcaaggaggaatgggcaaa
gcagacatcaacttcccaattatggaactgtgcactaaggaaatcacggcaaagggaagt
ttcagatatggaagtggtgattatacattggctcttcaattggttagtacagggaaggta
gatgtaaagaaattgattactggcgaagtgcaatttgaggatgcggagcaggctttcaag
agtgtgaaggaaggaaaggggattaaggtcttgatcaagggaccaaatgaaaattaa

DBGET integrated database retrieval system