KEGG   Botrytis cinerea: BCIN_06g00590Help
Entry
BCIN_06g00590     CDS       T01072                                 

Definition
(RefSeq) hypothetical protein
  KO
K10846  DNA excision repair protein ERCC-5
Organism
bfu  Botrytis cinerea
Pathway
bfu03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:bfu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    BCIN_06g00590
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bfu03400]
    BCIN_06g00590
DNA repair and recombination proteins [BR:bfu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     BCIN_06g00590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XPG_N XPG_I UIM 5_3_exonuc PDZ_5
Motif
Other DBs
NCBI-GeneID: 5440829
NCBI-ProteinID: XP_024549087
LinkDB All DBs
Position
6:complement(251503..255528)
Genome map
AA seq 1341 aa AA seqDB search
MGVTGLWTIVQPCARPTPLPALNRKRLAVDASIWIYQFLKAVRDKEGNALRNSHIVGFFR
RICKLLFHGIKPVFVFDGGAPILKRQTVLGRKRRREGRREDAVRTAGRLLGVQMKRRAEE
EDSERKRREREGQTRSRPVEEEEVAPEEQLAYVDEIGMSEQQVQTTRKFYKKDAYHLPEL
TNGIEGMGRPEDPRIMSAEELEEYARQFHNGEDVNLYDFSKIDFNGEFFMSLPAGDRYNI
LNAARLRSRLRMGLSKEQLEEMFPDRMAFSKFQIERVRERNELTQRLMNLNGMNSEEQMF
GVNGTNRIAGERGREYVLVKNDGVEGGWALGVVSLEKGVGDRNKPIDVDDYDRRNNKVDL
VSESEEDDFEDVPVEGLNRLPKPRDDRRNMTYSDFQAREVAERRKEYSNAKGKSNSNPTR
MPSEDPDSLFVDDVVGQPGPSSLNVNYDNEDEDINRAIAMSLQQDQDEDAELDEEDHLNR
AIELSLQKGYGQEEVEEDDPFEDVPIPEYEQRAVADARPLTKSSGKMIAHMVNNRANAAV
PKRKEETEKMDSDSDSDMDFQSALRKARTQTAPEKVRQAAPIVVNKKKPFDGPLPFESIQ
FKSSLFGKKKVEKLAEEPQVEDDDELAGGFEKEDEKEKAKPLPPWLIGNDDIRSQVQQQR
KKDQELNAKDRERAEEDDRIFQRDHGVIHVDSGDDNDSDVEVLDKAPTPNIVENSMDDLA
EAVKAQPPQSDVPQDRRPPVESRVEDTVDLLEDSDEPVEWSESDYGDVAPKSKKDPNSVD
PLEENMDVSSSKSKSPSPVFEDVDLPDVQATEPTHLSTSARNSPSPVFEDVQMADAISTL
PSDPTVASKPPFDDAYDRQEAEAIPDEFDFSDPEEEELMTQLAIEAEEHARFASTLNNKS
EKENHDSYEQDLKALRNQQKKDRRDADEVSHIMITECQALLRLFGIPYITAPMEAEAQCA
ELVRLGLVDGIVTDDSDIFLFGGTRVYKNLFNSNKLVECYLSSDLEKELSLSREQLISIA
HLLGSDYTEGIPGIGPVTAVEILSEFPSHAGLEEFKEWWSLVQNPLTTLPLASEPTLFRK
KFRRSQATKLFLPPAFPSQAVTEAYLKPDVDSTAEAFQWGVPDLGQLREFLMATVGWSQE
RVDEILVPVIRDMNRRETEGTQSNITRYFEGGVGVGGVGNGGAEGREKGSKRMREAVGKL
KAKKRGGATNSLGDRGTFADNAREWAKKNELSIEAQAKRDASKKEKGKGKGRKRVVEEVN
GDGDGDEGCEDEDMIVDADAEIEYNDADDYGDDDEEAEGEDSINSKPKPEDSEKGKGKGK
GRGRSNGKTMGQGVKRRKVTE
NT seq 4026 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtcaccggcctctggaccatcgtgcaaccctgcgctcgcccgactcccctccca
gctctcaaccgcaaacgactcgccgtcgacgcctcaatctggatctaccaattcctcaaa
gccgtgcgcgataaagaaggaaacgcgcttcgcaattcgcatatcgtaggattctttcgc
agaatatgcaaacttttgttccatggcattaaaccggtctttgtatttgatggtggtgcg
cccatattgaaacgtcaaacggtattggggaggaagaggcgaagagaggggaggagggaa
gatgcggttaggactgcagggagactcttgggggtacagatgaagaggagagcggaggag
gaagatagtgagaggaagaggagagaaagagaaggacaaacacgaagcagacctgttgaa
gaagaagaagtggcgccggaagaacaattagcatatgtggatgagatagggatgtcagag
caacaagtccagacgactcgaaaattctataaaaaggacgcatatcatttacctgaattg
acaaatggtatagaagggatgggcagaccggaagatccgagaatcatgtcagcagaggaa
ttggaagaatatgcgagacagtttcataacggagaagatgtgaatttgtatgatttcagc
aagattgactttaatggggagttttttatgagtttgccagcgggtgatcggtataatatt
ctgaatgctgcgaggttgaggagtagattgcggatggggttgagtaaggaacaattggaa
gagatgtttccggacaggatggcattctcgaaatttcagattgagagggtgagggaaaga
aatgagttgacgcagagattgatgaatttgaatgggatgaattcggaggagcagatgttt
ggagtcaatgggacaaatagaattgcaggagagaggggaagggaatacgttttggtcaag
aatgatggggtggaaggtggttgggcattaggtgtggtatccttggaaaagggagtggga
gataggaacaaaccgatcgatgtggatgattatgatcgaagaaataacaaagtggacttg
gtttctgaatctgaggaggatgatttcgaagatgttcctgttgaaggattgaatcggtta
ccgaaacccagggatgataggaggaatatgacttatagcgattttcaagcgagagaagtc
gctgaaaggaggaaagagtactccaacgcgaagggaaaatctaattcaaaccctacaaga
atgccatctgaggatccggattctctttttgtggatgatgtagtcggacaaccaggaccc
agctccttgaatgtaaattacgataatgaggatgaagatatcaatcgcgcgattgctatg
tcgttacaacaagatcaagatgaagatgcagaacttgacgaggaggatcatctaaatcga
gcgattgaattatcactccaaaagggctatggtcaggaagaggtggaagaggatgatcca
tttgaggatgtccctatcccagaatatgagcagagagcagtagcagatgctagacctctc
actaaatctagtgggaaaatgattgctcatatggttaacaatagagctaacgctgctgta
ccgaaacggaaggaagagaccgagaagatggacagtgatagtgatagcgatatggatttt
caatccgcattgaggaaagcaaggacacaaacggcaccggaaaaggtccgccaagcagca
ccaattgtcgtaaataaaaagaaacctttcgatggaccattgccattcgagagtatccaa
ttcaaatcatctttatttggcaaaaaaaaagtagaaaaattagctgaagaaccacaagtg
gaagatgatgacgaactagctggtggtttcgagaaagaagatgaaaaagaaaaggcaaaa
ccactacctccttggttgattggcaatgatgatatcagatcacaagttcaacagcagcgt
aagaaagatcaagaattgaacgcaaaggatcgcgaaagagcggaagaagacgacaggatc
tttcaacgtgatcatggggttattcatgtagattctggtgatgataatgatagtgatgtg
gaagttttggataaagcgcccacgcctaatattgtcgagaatagtatggatgatttggca
gaagctgttaaagctcaaccgccgcagtctgatgttcctcaggatagacggccaccggta
gaatctcgtgtggaagatacagttgatttgttagaggattctgatgaaccagtagagtgg
tcggagagcgattatggggatgtggctcctaagtctaagaaggatcccaattctgtagat
cccctcgaagagaatatggatgtgtcttcttcgaaatcgaagtcgccgtctcctgttttc
gaagatgtggatcttcctgacgttcaagcaactgaacctacacacctatcgacttctgca
agaaatagtccgtctcctgtgtttgaagatgttcaaatggcagatgctatatctaccttg
ccatctgatccaactgtagccagcaagccacctttcgatgatgcatatgatcgtcaagaa
gctgaagcgattccggatgaatttgattttagtgatccagaagaagaagaattaatgacg
caactcgctatcgaagcagaagaacatgctcgctttgccagtaccctgaacaacaaatcg
gaaaaagaaaaccatgattcctatgagcaagatctcaaagcattgcgaaatcaacaaaag
aaagatcgtagagatgcagatgaagtatctcatatcatgatcacagaatgtcaagctcta
ctccgtctcttcggtattccttacatcaccgcaccaatggaagcagaagcccaatgtgct
gaacttgtccgtctgggtcttgtagatggcattgttacagatgattcggatatttttctt
ttcggtgggacgagagtttataagaatttatttaattccaataaactcgttgagtgttac
ctctcatccgatctggaaaaagaactctcgctctccagggaacaacttatctcaatagct
cacttactaggctcggattacacggaaggaatccccggtattggacccgtcactgctgtg
gagatcctctcggaatttccatctcatgccggtcttgaggaattcaaagaatggtggtcc
ctcgtccaaaatcctcttacaactcttccgcttgcaagtgaaccaacgctttttcgcaaa
aaattccgtcgctcacaggctacgaaactctttctacccccagcatttccgagtcaggcg
gttacagaagcatatctcaaaccggatgtcgatagtacggccgaggctttccaatgggga
gtcccggatctaggacaattgagagaatttttgatggccacggtgggttggagtcaagaa
cgggtggatgaaattttagtgccggtgattagggatatgaatagacgggaaacggagggg
acgcagagtaatattacgagatactttgagggtggagttggggtggggggcgtagggaat
ggtggggcagaggggagggaaaaggggagtaagaggatgagagaggcggtaggaaagttg
aaggcgaaaaagaggggcggagctacgaattcgttaggggatagaggtacctttgcggat
aatgcgagagagtgggcgaagaagaatgaattgagtatcgaggcgcaagcgaaacgagac
gcgagtaaaaaggagaaggggaaggggaaggggaggaaaagagtggtggaggaggtaaat
ggggatggggatggggatgagggatgcgaggatgaagatatgattgtggatgcggatgct
gaaatagagtataatgatgcagatgattatggtgatgatgatgaagaggcagagggagag
gactcaataaattccaaaccaaaaccagaggattcggaaaaaggaaaaggaaaagggaag
ggaagaggaagaagcaatgggaaaacaatgggacaaggggtcaaaagacgaaaggttacg
gaataa

DBGET integrated database retrieval system