KEGG   Botrytis cinerea: BCIN_08g06300Help
Entry
BCIN_08g06300     CDS       T01072                                 

Definition
(RefSeq) hypothetical protein
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
bfu  Botrytis cinerea
Pathway
bfu00010  Glycolysis / Gluconeogenesis
bfu00030  Pentose phosphate pathway
bfu00051  Fructose and mannose metabolism
bfu00052  Galactose metabolism
bfu00680  Methane metabolism
bfu01100  Metabolic pathways
bfu01110  Biosynthesis of secondary metabolites
bfu01130  Biosynthesis of antibiotics
bfu01200  Carbon metabolism
bfu01230  Biosynthesis of amino acids
bfu03018  RNA degradation
Module
bfu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCIN_08g06300
   00030 Pentose phosphate pathway
    BCIN_08g06300
   00051 Fructose and mannose metabolism
    BCIN_08g06300
   00052 Galactose metabolism
    BCIN_08g06300
  09102 Energy metabolism
   00680 Methane metabolism
    BCIN_08g06300
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    BCIN_08g06300
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bfu01009]
    BCIN_08g06300
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bfu03019]
    BCIN_08g06300
Enzymes [BR:bfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BCIN_08g06300
Protein phosphatases and associated proteins [BR:bfu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BCIN_08g06300
Messenger RNA biogenesis [BR:bfu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     BCIN_08g06300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK UVR TgMIC1
Motif
Other DBs
NCBI-GeneID: 5430647
NCBI-ProteinID: XP_024550556
LinkDB All DBs
Position
8:complement(join(2345981..2347147,2347196..2347663,2347714..2348454))
Genome map
AA seq 791 aa AA seqDB search
MAPQPPPPLEGKKRRIAIMTSGGDSPGMNGVVRACVRMAIYKGCEPYCIYEGYEGLVQGG
KLIKKMGWEDVRGWQSEGGTLIGTARCMAFYERPGRLQAAKNMVLNGIDALIICGGDGSL
TGADKFRAEWPGLIKELIEKKELSEQQVAPFKNLNIVGLVGSIDNDMSGTDATIGCFSAL
GKICEMVDYIEQTASSHSRAFVIEVMGRHCGWLALMAGVATGADFVFIPEKPRADNWKEE
MHKVIQKHRQLGKRKTIVIVAEGAHDQGGNKISPEMIKDLLADKNGLALDTRISTLGHVQ
RGGSACAYDRYLSTLQGIEAVNAVLDATPETVTPFIAINENKITRKPLVQSVIDTQEVAK
AIEAKDFERAMALRDTEFSDFYDSYMTTTATDLNNEMRLPDKKHMRIAIVHVGAPAGGVN
AATRAAVAYCLTRGHTPIAIHNGFAGFARHHQDNPGSVREFDWLEVDGWASKGGSEIGMN
RELPSESGMPLIASLFEKFKIDGLLIIGGFEGFHALSELRQARETYSSLCIPMTLLPATI
SNNVPGTEYSIGSDTCLNELVRYCDTIKQSASASRRRVFVIETQGGRSGYVATMAGLAVG
ASAVYTPEEGVSIGMLSADIAHLKEVFEQDSGQSRAGRLILINEKASKVYNAKLIADMIR
EEARDRFESRDSIPGHVQQGGTPSPMDRTRAVRLAIKCIEHLEQYEDRTDKKILGDKQSS
TVIGIKGAQVVFSSMVDVEENETDWPNRRPKDEFWLDLKGTVDILAGRPDVPRPERKLKG
WKAKDSKRGLI
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atggctcctcaacccccaccacccctcgagggaaagaagcgccgcatcgctatcatgact
agtggaggtgattctcccggtatgaacggcgttgtgcgagcttgcgttcgaatggccatt
tataaaggatgcgaaccatactgtatctacgaaggatatgaaggtttggtccaaggagga
aaattgatcaaaaagatgggctgggaagatgttcgtggatggcaatcagaaggaggtact
cttattggtactgccagatgtatggctttctatgagcgacccggcagattacaagcagca
aagaatatggtgttgaatggaattgatgctctcatcatctgtggtggtgacggttccttg
actggagctgataaattcagagcggaatggcctggcttgatcaaggaattgatcgaaaag
aaggaattatcagaacaacaagttgccccattcaagaatctcaatatcgttggattggtc
ggttcaattgataatgatatgtctggtaccgacgctacaattggttgcttttcggccctg
ggcaagatttgcgagatggtggattatatcgaacaaactgcttcatcgcattcaagagct
ttcgttattgaagttatgggtagacattgcggttggttagctttgatggctggtgttgct
actggtgcagattttgtcttcattccagaaaaaccaagagcagacaactggaaagaagag
atgcacaaggtcatccagaagcatagacaattgggaaagagaaagacgattgttattgtt
gccgaaggtgctcacgatcaaggaggaaataagatttctccagaaatgatcaaggatctt
cttgcagacaagaatggtctcgctcttgatacacgtatttcaacattgggtcatgttcaa
cgtggtggttctgcatgcgcttacgatcgatacctttctactttacaaggcatcgaagca
gtaaatgctgttcttgatgctaccccagaaacggtcactccttttatcgccattaacgaa
aacaaaatcaccagaaaaccactggttcaatccgtcattgatactcaagaagtagcaaag
gctatcgaagcaaaggatttcgagagagctatggcactcagagatacagagttttctgac
ttttatgattcctacatgactacaacagctactgatctcaacaatgaaatgcgtcttcct
gataagaagcacatgagaattgctattgtgcatgtcggagctccagctggtggtgttaat
gctgctacgcgtgcagctgttgcttattgcttaactcgtggacatacaccaattgctatt
cataatggtttcgctggattcgcccgtcatcaccaagataacccaggatcggttcgagaa
tttgattggctagaagttgatggatgggctagtaagggtggttcagaaattggtatgaac
cgtgaacttccatcggaatctggaatgccattgatcgcatcactttttgaaaaattcaag
attgatggtcttctcattattggaggtttcgaaggtttccatgccttgtccgaacttcgt
caagcaagagaaacttactcttctctttgcattcctatgactttacttccagccactatc
tccaataatgttccaggaacagaatattcgattggttcagatacttgtttgaacgaactt
gtccgttattgcgataccattaaacaatccgcttcagcttcccgtcgtcgtgttttcgtc
attgaaacccaaggtggtcgatctggttacgttgctaccatggctggtctcgctgttggt
gcatcagctgtctatactcctgaagaaggtgtcagtattggtatgctctcagcagatatc
gcacatctcaaggaagttttcgagcaagacagtggtcaatcaagagctggccgtcttatc
ctcatcaacgaaaaagcatcaaaggtttacaacgctaaactcatcgctgatatgatccgt
gaagaagctcgcgatcgtttcgaatccagagatagtatcccaggtcacgttcaacaaggt
ggtactccatcccctatggaccgtacccgagccgttcgcttagctatcaaatgtattgaa
catctcgagcaatatgaagatagaaccgataaaaagattcttggggataaacaaagttca
acagttattggcattaagggtgcacaagttgtattctctagtatggttgatgttgaggaa
aatgaaacggattggccaaatagaagaccaaaggatgagttctggttggatttgaaggga
actgtggatattcttgctggtagacctgatgttcctagaccggagcgtaaattgaagggt
tggaaggcgaaggatagtaagaggggtttgatttga

DBGET integrated database retrieval system