KEGG   Botrytis cinerea: BCIN_09g00820Help
Entry
BCIN_09g00820     CDS       T01072                                 

Gene name
Bcgst6
Definition
(RefSeq) Bcgst6
Organism
bfu  Botrytis cinerea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N_3 GST_N GST_C_3 GST_N_2 GST_C_2 GST_N_4 DUF3791
Motif
Other DBs
NCBI-GeneID: 36394461
NCBI-ProteinID: XP_024550674
LinkDB All DBs
Position
9:complement(297880..298533)
Genome map
AA seq 217 aa AA seqDB search
MLPITLYSHPFGPNPWKVALILEELNIPYTTKFVDFSEVKKEPYIQLNPNGRLPSIEDPN
TDITLWESGAIIEYLIEKYDVNHQLSYNTFAETYLAKQWLHFQASGQGPYYGQASWFTNL
HPEKIQSVIDRYANEIRRVTGVLESVLKTREWLVGDKCTYADLCFIAWQRWAPRYGGEDI
YKDYPHVEAWLERMKMRPAVKKIYADQDFAMTEAQKK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgcttccaatcacactttattctcatcctttcggtcctaacccgtggaaggtggccctc
atcctcgaggagctgaacatcccatacacaacaaaatttgtggatttctccgaagtcaag
aaggagccgtatatccaactcaatccaaacggacggctgccatctatcgaagaccctaac
accgacattacactctgggagtccggagccatcatcgaatacttgattgaaaagtatgat
gttaatcaccagttgagctacaacaccttcgccgaaacgtatcttgctaagcagtggctg
cacttccaagcttctggtcaagggccatactatggtcaagcctcttggttcaccaatctc
caccccgaaaaaatccaaagtgttatcgaccgatatgcaaacgagatccgtagagtcact
ggagttcttgaatccgtgttgaaaacgcgagaatggctggtcggggacaaatgcacatac
gcggatctttgtttcatagcatggcaaagatgggcacctcgatatggtggtgaagatatc
tataaggattacccgcatgtggaggcatggctggagaggatgaaaatgaggcctgcagtc
aagaagatttatgctgatcaggacttcgccatgacagaagcccagaagaaatga

DBGET integrated database retrieval system