KEGG   Botrytis cinerea: BCIN_09g00980Help
Entry
BCIN_09g00980     CDS       T01072                                 

Definition
(RefSeq) hypothetical protein
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bfu  Botrytis cinerea
Pathway
bfu00020  Citrate cycle (TCA cycle)
bfu00480  Glutathione metabolism
bfu01100  Metabolic pathways
bfu01110  Biosynthesis of secondary metabolites
bfu01130  Biosynthesis of antibiotics
bfu01200  Carbon metabolism
bfu01210  2-Oxocarboxylic acid metabolism
bfu01230  Biosynthesis of amino acids
bfu04146  Peroxisome
Module
bfu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bfu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCIN_09g00980
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BCIN_09g00980
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    BCIN_09g00980
Enzymes [BR:bfu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BCIN_09g00980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 5427127
NCBI-ProteinID: XP_024550688
LinkDB All DBs
Position
9:complement(join(373930..374354,374416..374952,375033..375423))
Genome map
AA seq 450 aa AA seqDB search
MSLHRSITSSLLRSAPRTSIFTPRFGSAITQSRTMASAASFQKIKVKNPIVELDGDEMTR
IIWKDIKDKFIHPYLDVDLKYYDLGLEYRDQTNDQVTIDAAEAIKKYSVGVKCATITPDE
ARVKEFNLKQMWLSPNGTIRNHLGGTVFREPIVIPRIPRLVPGWKKPIIIGRHAFGDQYR
AKDMVVPGPGTLTMTFTPKDGKPTETVVYDFKSGGGVAQTQYNTDESISGFAHASFKMAL
NKGLPLYMSTKNTILKKYDGRFKDIFEEIFQKEYKTQFEAKNIWYEHRLIDDMVAQMMKS
SGGYVMALKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFESEAAHGTVTRHYREHQK
GNPTSTNPIASIFAWTRGLIQRGNLDNTPEVVAFAESLEQACVDVVDKEGIMTKDLALAC
GNTGKGDYVTTGEYLEAVERRMKGLLKEKL
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgtctctccaccgcagtattacctcttcccttcttcgcagcgcacctcgaacctcaatc
ttcaccccacgatttggcagcgccattacacaatcgcgcaccatggcatccgcagcttct
ttccaaaaaatcaaggtcaagaatccaattgtggaattggatggtgacgaaatgacccgc
attatctggaaggatatcaaggataaattcattcacccttatttggatgttgatctgaaa
tattatgatttggggttggagtatagagatcagaccaatgatcaggtcacaattgatgcg
gcagaggctattaagaagtattctgtcggtgtcaagtgtgctactattaccccagatgaa
gctagagttaaggaattcaatttgaagcagatgtggctctcaccaaacggtaccatccgt
aatcatctaggaggaaccgtcttccgcgaacctatcgttattccacgtatcccacgtctc
gttcccggctggaaaaagcctatcatcatcggtcgtcatgcatttggagatcaataccga
gccaaagatatggtggttccgggtccaggtactcttaccatgacttttactccaaaggat
ggcaagccaaccgaaaccgttgtctatgatttcaaatcaggaggaggagttgctcaaacc
caatacaataccgatgaatccattagcggatttgcgcatgccagtttcaagatggctctt
aacaagggattgcctctgtatatgagcaccaagaacacaattttgaagaagtatgatggt
agattcaaggatatctttgaggagattttccaaaaggaatacaagactcaatttgaggcg
aagaacatctggtatgaacatcgattgatcgatgacatggttgcgcaaatgatgaagagt
tcaggtggttatgttatggccttgaagaactatgacggagatgtccaatctgacattgta
gcccaaggatttggttccctcggtcttatgacctcagttctcatcacccccgatggaaag
accttcgaatctgaagccgcccacggaaccgtcacccgtcattaccgcgaacatcaaaag
ggtaaccctacatccacaaaccctatcgcatcaatctttgcctggacaagaggtttgatt
caaagaggtaacttggataatactccagaagttgtggcctttgcagagagtttggaacaa
gcttgtgtggatgttgttgacaaggagggaattatgacaaaggatttggcattggcttgt
ggaaacaccggaaaaggagattatgttaccactggagaatatttggaggcagttgagagg
aggatgaaggggcttttgaaggagaagttgtag

DBGET integrated database retrieval system