KEGG   Botrytis cinerea: BCIN_09g04690Help
Entry
BCIN_09g04690     CDS       T01072                                 

Definition
(RefSeq) hypothetical protein
Organism
bfu  Botrytis cinerea
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 5432148
NCBI-ProteinID: XP_001551638
UniProt: A0A384JT21
LinkDB All DBs
Position
9:join(1648332..1648525,1648583..1649075)
Genome map
AA seq 228 aa AA seqDB search
MNSPNNATSGHYCEIDRFRCLKCEHDDYRHRYRCERHLLGDAYCRETIPMITRDRNVFCK
ECAEDEDLEAGGQSHMSAEPSAVHFVDVNTNIIQEVIEIQPVSTDASQSEDTVGPDMPSG
GWGEPGGISLQRLNLQSSARVPPDQDLAIEPLAPQNFLTVPPSSTHINTNTAPPSAPPTT
PPPPPIPAPPPTPPPTPPSTPEPASEETTRQAGTWERLYRRWCCWSSE
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaattctcccaacaatgcaacctctggccactattgcgagatagacaggttcagatgc
ttgaaatgcgagcacgatgattaccgccaccgataccgatgcgaacggcatttgcttggg
gatgcgtattgcagagagacgatccccatgatcacgcgagatcgaaatgtgttttgtaaa
gagtgcgcggaagatgaggatctagaagctggtggccagagccatatgtcagcggaacca
tcagcagttcattttgtggacgtcaataccaatatcattcaagaagtaatagagatccag
cctgtatctaccgatgcttcgcaatcagaggatactgttgggccagatatgccatcagga
ggatggggcgagccgggaggcatatcgcttcagagattaaatctgcaatcctcagctcgt
gtacctccagaccaagatctcgcgatagagccactggcgcctcaaaatttcctcacagta
ccgccatcatcaactcatatcaatacgaataccgcaccgccatcagcaccaccgaccaca
ccaccaccaccaccaataccagcacccccaccaacaccacccccaacaccaccttcaaca
ccggaaccagcatcagaagaaacaacaagacaggcaggaacatgggagcgattgtacagg
cggtggtgctgttggagttcagaataa

DBGET integrated database retrieval system