KEGG   Botrytis cinerea: BCIN_09g05020Help
Entry
BCIN_09g05020     CDS       T01072                                 

Gene name
Bcgad1
Definition
(RefSeq) Bcgad1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
bfu  Botrytis cinerea
Pathway
bfu00250  Alanine, aspartate and glutamate metabolism
bfu00410  beta-Alanine metabolism
bfu00430  Taurine and hypotaurine metabolism
bfu00650  Butanoate metabolism
bfu01100  Metabolic pathways
bfu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BCIN_09g05020 (Bcgad1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BCIN_09g05020 (Bcgad1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BCIN_09g05020 (Bcgad1)
   00430 Taurine and hypotaurine metabolism
    BCIN_09g05020 (Bcgad1)
Enzymes [BR:bfu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     BCIN_09g05020 (Bcgad1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 5432206
NCBI-ProteinID: XP_001551694
UniProt: A0A384JTM3
LinkDB All DBs
Position
9:join(1752500..1752517,1752583..1752821,1752890..1754306)
Genome map
AA seq 557 aa AA seqDB search
MSLARHVDPDQIIQNLQNMHMKEAGQKHVHTNGGTSHITPYSTRYASKQEISKFEIPKDG
APADAVHQMLKDELDLDGRPNLNLASFVGTYMETHAEQLMFENISKNMSDADEYPAMMQM
HTRCVSIIANLWGAQKGEKAIGSATTGSSEAIHLGGLAMKRRWQEKREAEGKDKSKPNII
MGSNAQVALEKFARYFEVEARILPVSEKSNFRLDPELVKDNIDENTIGIFVILGSTYTGH
YEPVEEISKILDDYEAKTGVDIPIHVDAASGGFVAPFTHAQAGGPKWNFELPRVKSINTS
GHKFGLVYAGVGWIIWRDESYLPKHLVFELHYLGGTEESYTLNFSRPGAQVIAQYYNLIH
LGFNGYRQIMENCMSNARLLSKSLESTGWYTCVSDIHRKKGEHTFQGLSAPVFSKEDETS
ADYNAGLPVVAFRFSDEFKKEFPHIEQETISNLLRAKQYIIPNYPLPPNEEKTEILRVVV
RESMSFDLLDRLISDICSTTQNLIDNDTQDLSILSKQLTKGHGSAEKTHGSVGHKHGKGQ
GKGGNRPMSHGVHRAVC
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtctctcgcacgccatgtcgacccggatcagatcatccaaaatctacagaatatgcat
atgaaagaagcgggccaaaagcatgtacataccaatggtggaacctctcatattactcca
tactcgactcgatatgcttccaaacaagaaatttctaagtttgaaataccaaaagatggt
gccccagcagatgctgttcaccaaatgttgaaggatgaattagatctcgatggccgacct
aatttaaatttggcaagttttgtgggtacatacatggaaactcatgccgaacaattaatg
ttcgagaatatttcaaagaatatgtccgatgcagacgaatatccagcaatgatgcaaatg
catacccgatgtgtttctatcatcgctaatctttggggagcacaaaagggagagaaagct
attggatctgcaacaactggttcttcagaagctatccaccttggtggtttagctatgaag
agacgttggcaagaaaagcgtgaggctgaaggaaaagataaatccaagccaaatatcatc
atgggatcgaatgctcaagtagctcttgagaaattcgccagatactttgaggtcgaggct
agaattcttcctgtttctgaaaagtcaaacttcagacttgatccggaattggtcaaggat
aatattgatgagaataccattggtatttttgttattctaggaagtacatacaccggtcat
tatgaaccggttgaagaaatttccaaaattttagatgattatgaagccaagactggagtc
gatatcccaattcatgtcgacgctgcatccggaggctttgtagctccattcacccatgct
caagctggtggtccaaagtggaactttgagctcccacgagtcaaatccatcaacacatcc
ggtcacaaattcggtctcgtgtacgcaggtgtaggctggatcatctggcgcgatgagtct
taccttcccaaacatcttgtcttcgaactccattatctaggtggaacagaagaatcctac
actcttaacttttctcgaccaggtgctcaagttatcgctcagtactataacctcattcat
ctcggtttcaatgggtatcgtcaaatcatggaaaactgcatgagcaacgcccgtcttctt
tcaaaatctctcgaaagcactggatggtatacatgcgtctccgacattcatcgcaagaaa
ggcgaacacacattccaaggcctaagtgccccagtcttcagcaaagaagacgaaacctcc
gctgattacaacgccggtctccccgtcgtcgctttccgtttctcagacgaatttaagaaa
gaatttccacatatcgaacaagaaaccatctcaaatctcctccgcgctaagcaatatatt
atccctaactatccccttcctcccaacgaagaaaagactgagattctcagagtggtggtt
agagagagtatgagctttgatctgttggatagattgatctcggatatttgttccacgaca
caaaacttaattgataatgatacgcaggatctgagcattttgagtaaacagttaactaag
ggacacggaagcgcggagaagactcatggaagtgtgggacacaagcatggaaagggacaa
ggaaagggtggaaacagaccaatgagtcatggagtacatagagcggtttgctag

DBGET integrated database retrieval system