KEGG   Botrytis cinerea: BCIN_11g03830Help
Entry
BCIN_11g03830     CDS       T01072                                 

Definition
(RefSeq) Bcgst17
Organism
bfu  Botrytis cinerea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_5 GST_C_3 Glutaredoxin GST_C
Motif
Other DBs
NCBI-GeneID: 5439192
NCBI-ProteinID: XP_024551790
LinkDB All DBs
Position
11:complement(join(1429202..1429609,1429661..1429741,1429833..1430010,1430081..1430175,1430469..1431012,1431069..1431685))
Genome map
AA seq 640 aa AA seqDB search
MDQVNSGLHQQIPTTYRQLQPQAEQALQHGQPHLHHHTLTSQAGLDLSGLVQDDNNSVYH
PDLRSLQDPNAGHPIAHQYPSPIPFERNNGHPQMHVQNPGIQNTGLQNSIQNNGSPHTPQ
QQHPGPGQFGILTAGPSLHHNPIGRLQQGLPQDLQQDDNLFGTPDETDQKSIGHHSHKIV
PNPPDLAAWREKLFNVNEMITLSEEEYNTYFPHVDNVYSHRSTQKYKRKPFVSHYWDCRL
KGRPPGTAKSDDPNKKKRKRTARERDLCDVKIKITEYFPGAMLRADFQPDGGASADPSQA
NNFFAQAGPHQQQFALPLNNINIPPNHPGATGQRYYEIQRVNGNGGNGKGDGVAGPHKHD
LARSDEIKKNSILRFLQKREKEDKKTQKTYHKRASGLALSTVKKHTKENDLKLFGSCFCP
FVQRVWIALEAKGIQYQYIEVDPYKKPQSLLEVNPRGLVPAIRHGDWGCGESTVLMEYIE
DLQTGPPLFPQDARAKAHSRLWADHMDRKIVPTFYALLQSQNYEKQEELTAKLRDEISQI
VDVCDPQGPFFLGPTLTYTDVHFAPWILRCRRVLKHYRDWQDPQPGSRWAIWFDAIENNE
FVKATTSADELYIDSYERYAMNRPGTSELADAVNGGFNLP
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atggatcaagttaattcaggtcttcaccagcagatacccacaacatacagacaattgcag
ccacaagcagaacaagctctccagcatggccaacctcatcttcaccaccacactcttaca
tcccaggcaggactcgatctgtcgggcttggtccaagatgataacaattctgtctatcac
ccagacttgagaagcttgcaggatccaaatgcaggacatcctattgctcatcagtatcct
tctccaatccctttcgaaagaaataatggacaccctcaaatgcatgtccagaatcctggc
attcaaaatactggacttcaaaatagcattcaaaataatggcagcccccatacccctcaa
cagcaacatcctggaccaggacaattcggaatcttgactgcaggtccttctcttcatcat
aacccaatcggcagattgcagcaaggtttgccccaagatttgcagcaagatgataattta
tttggcacacccgatgaaacagatcagaaaagcattggacatcattctcacaagattgtg
cccaatcctccagatttggcggcatggagagagaagttattcaatgtcaatgagatgatc
actttgagtgaagaagagtataatacgtattttcctcatgtcgacaacgtttactctcat
cggtcgactcaaaagtacaagcgcaagccatttgtttctcactactgggattgtcgtctc
aaaggtaggccgccaggaactgccaaatccgatgatccaaacaaaaagaagcgaaagcgc
actgcgcgagaaagagatctttgcgatgtcaaaatcaagatcacagagtacttcccgggt
gctatgttacgggcagattttcaaccagatggaggcgcatcggcagatccatcccaagcg
aacaacttttttgcgcaagctggacctcatcaacaacaatttgcccttcctctcaacaat
atcaatatcccgccaaatcatccaggcgccacaggccagcgatactatgaaatccagcgt
gtcaatggaaacgggggcaatggcaagggtgatggcgttgcgggacctcacaagcatgat
ctggcgagaagtgatgagatcaaaaagaacagtattcttcgatttctccaaaagcgagag
aaggaggacaaaaagacccagaaaacttatcacaagagagccagtggtctagccttgagt
accgtgaagaaacataccaaggagaatgatttgaagctatttggcagttgcttttgccct
tttgttcaacgagtttggattgctttagaagccaaaggtattcagtatcaatatattgaa
gttgatccatacaaaaagcctcaatctttgttagaggtcaatcccagaggattggttcct
gctattcgtcatggagattggggctgtggtgaaagtactgttttgatggaatacatcgaa
gaccttcaaaccggcccacctctatttccccaggatgcgcgagctaaagctcatagcaga
ctttgggccgaccacatggatcgtaaaattgtccccacattctacgcactcctccaatca
caaaactatgaaaagcaagaagaattgaccgcaaaacttcgcgatgaaatctctcagatt
gtagacgtatgcgatcctcagggtccattttttctcggtccaacgctcacttataccgat
gttcattttgcaccatggattctccgttgccgtcgtgttcttaagcattatcgagattgg
caagatccgcaaccgggtagtcgttgggcgatctggtttgatgcgattgagaataacgag
tttgtcaaggcgacgaccagtgcagatgaattgtacattgattcttatgagagatacgcg
atgaatagaccgggaacaagtgagctagcggatgcggtaaatgggggtttcaatttacct
tag

DBGET integrated database retrieval system