KEGG   Botrytis cinerea: BCIN_11g05700Help
Entry
BCIN_11g05700     CDS       T01072                                 

Gene name
Bchxk
Definition
(RefSeq) Bchxk
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
bfu  Botrytis cinerea
Pathway
bfu00010  Glycolysis / Gluconeogenesis
bfu00051  Fructose and mannose metabolism
bfu00052  Galactose metabolism
bfu00500  Starch and sucrose metabolism
bfu00520  Amino sugar and nucleotide sugar metabolism
bfu01100  Metabolic pathways
bfu01110  Biosynthesis of secondary metabolites
bfu01130  Biosynthesis of antibiotics
bfu01200  Carbon metabolism
Module
bfu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bfu_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BCIN_11g05700 (Bchxk)
   00051 Fructose and mannose metabolism
    BCIN_11g05700 (Bchxk)
   00052 Galactose metabolism
    BCIN_11g05700 (Bchxk)
   00500 Starch and sucrose metabolism
    BCIN_11g05700 (Bchxk)
   00520 Amino sugar and nucleotide sugar metabolism
    BCIN_11g05700 (Bchxk)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    BCIN_11g05700 (Bchxk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bfu04131]
    BCIN_11g05700 (Bchxk)
Enzymes [BR:bfu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     BCIN_11g05700 (Bchxk)
Membrane trafficking [BR:bfu04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    BCIN_11g05700 (Bchxk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 5429617
NCBI-ProteinID: XP_001549109
UniProt: A0A384JXQ7
LinkDB All DBs
Position
11:complement(join(2016490..2016913,2016969..2017423,2017475..2017882,2017930..2017955,2018010..2018132,2018880..2018919))
Genome map
AA seq 491 aa AA seqDB search
MVGLGPRKPPSRKGSMADVPKNYLEQIKKLEQQFTVDTQKLKEITEHFVSELTKGLTVEG
GSIPMNPTWCMAFPDGYETGTFLALDMGGTNLRVCEIILTDEKSEFDIIQSKYRMPEELK
TGEADELWEYIADCLQQFIESHHHGEDLGTLSLGFTFSYPATQNYIDEGILQRWTKGFDI
AGVEGENIVPMFEAALAKRGVPIKLTALINDTTGTLIASAYTDTAMKIGCIFGTGCNAAY
MENCGSIPKLAHMNLPPDTPMAINCEWGAFDNEHKVLPRTPYDIIIDKDSPRPGQQAFEK
MIAGLYLGELFRLVLVDLHDNKDIHMFEGQDIEKLRKAYTLDSSFLSLVEEDPWENLSET
ADLFQNKLSIRATVPELELIRRLAELIGTRAARLSACGVAAIAKKKNYETCHVGADGSVF
NKYPHFKARGAAALREILDWPAKKNAKEADPIEILAAEDGSGVGAALIAALTLKRVKAGN
MAGILHPENFR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggtggggttaggtccaagaaagcctccttcccgtaagggttctatggctgatgtcccc
aaaaattacttggaacaaatcaagaagcttgagcaacagttcactgttgacacccaaaaa
ctcaaggagatcactgaacacttcgtctccgagcttacaaaaggtctcactgtagagggt
ggaagtattccaatgaacccaacttggtgtatggcatttccagatggttatgaaaccggt
acattcctcgccttggacatgggaggtaccaacttgcgtgtctgtgaaattatcttgact
gatgagaagtccgagtttgatattatccaatcaaaataccgcatgccagaagagctcaag
actggcgaagcagatgaactttgggaatacattgccgattgtcttcaacaattcattgaa
tcccaccatcatggcgaggatcttggaacgttgagtcttggtttcaccttctcctaccca
gctactcaaaactatatcgatgagggtatcttgcaaagatggaccaagggcttcgatatt
gcaggtgtcgaaggtgaaaacattgttccaatgtttgaggcagctcttgctaagagaggc
gttccaattaagcttacagctttgatcaatgataccactggtaccttgattgcttccgca
tatactgacacagccatgaagattggttgtattttcggaactggttgcaatgctgcgtac
atggaaaactgcggctctattccaaaattggcacacatgaacttacctcctgacactcca
atggcaatcaactgcgagtggggtgctttcgataatgagcacaaagttctcccccgtact
ccatacgatatcattattgataaagattctccacgtcctggtcagcaagcatttgagaag
atgattgctggtctttaccttggagaacttttcagattggttcttgtcgatcttcatgac
aacaaagatatccacatgtttgagggtcaagatattgaaaaactccgaaaggcttacacc
ttggactcttcattcttgtcattggttgaggaggacccttgggagaacttgtcagaaact
gctgatcttttccaaaacaagctcagcatcagagccactgttccagaactcgagctcatc
cgtcgccttgctgagttgatcggtacccgtgccgcccgcctctccgcatgtggtgtcgcc
gccattgccaagaaaaagaactacgagacttgccacgtcggagctgacggatctgtcttc
aacaaataccctcacttcaaggctcgtggtgccgccgcactccgtgaaattcttgattgg
cctgcaaagaagaatgctaaggaggctgatcccattgaaatcttggctgctgaggatgga
tctggtgtcggtgcagctttgattgctgctttgaccctcaagcgtgtcaaggcaggtaac
atggctggtattttgcacccagagaacttcagatag

DBGET integrated database retrieval system