KEGG   Botrytis cinerea: BCIN_11g06440Help
Entry
BCIN_11g06440     CDS       T01072                                 

Definition
(RefSeq) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
bfu  Botrytis cinerea
Pathway
bfu00052  Galactose metabolism
bfu00500  Starch and sucrose metabolism
bfu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BCIN_11g06440
   00500 Starch and sucrose metabolism
    BCIN_11g06440
Enzymes [BR:bfu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     BCIN_11g06440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N DUF1533
Motif
Other DBs
NCBI-GeneID: 5428801
NCBI-ProteinID: XP_001548290
LinkDB All DBs
Position
11:complement(2281897..2284890)
Genome map
AA seq 997 aa AA seqDB search
MGGKLGVTVAAFAAAILHTTYAQSPTSPQSNTTTSYRSVYTLPASVDVSAPVIPNIQDPQ
AVNAQDVCPGYTASDIKRTHYGWTAFLTLAGDACNVYGTDVDSLNLTVEYQSKDRLHVEI
VPTYVGPSNSSWFILPESLVEKPSIDADANSTALDSDLSFLWSNDPTFSFSIFRQSTGDV
LFSTEGSKLIYENQFIEFISSLPENYNLYGLGESIHGFRMGNNFTRTFWAADVGDNIDAN
IYGNHGIYLDTRYYEVDASTGNMTYVANATNVTADYVSYTHGVYQRNAHGQEVLMKPSNI
TWRTLGGSIDLYFYAGPTQEKVTKAYQMSAIGLPAMQQYFTFGYHQCRWGYANWTELGKV
VDNFANFGLPLETIWLDIDYMNQYRDFEVDEVRFGYSEGAEFISKLHGNGQHIVPIVDSA
IYIPNPENETDAYPPFNRGNATDSFMLNPDGSLYIGSVWPGYTVFPDWIGSVLNGTGAHQ
WWSDELTAWHSNFSFDGIWIDMSEVSSFCVGSCGSDNLTLNPVHPPFLLPGEPGNIDFIY
PEGFNLTNATEAAAASSSSASQSSAYATSSASSSSQSTSYIRTTPTPGVRDIVYPPYTIN
NFLGSLDVHAVSPNATHHGGTQEYDYHNLFGHQILNATYNALLNVSPSKRPFIIGRSTFA
GSGKWAGHWGGDNYSLWAYMFFSIPQALSFSLFGIPMFGADTCGFSGNSDEELCNRWMQV
SAFFPFYRNHNTLAAPSQEPYVWASVIDATKAATTIRYTLLPYIYTTFYMAHSTGSTVMR
ALAWEFPNDPTLASADRQFLLGPNIMVTPVLEQGATTVDGVFPGSGKGQVWYDWYNQSAI
TSSPGQNITIDAPLGHIPVYIRGGSILPIQEPALTTQECRNNPWGLLVASSLEGTAIGEL
YLDDGESLAPNATLWVDFSMTQNSLYASGRGSYIDNNPLANITIMGILSSVSNVTLNGVS
LTSGWMYNSTSQVLDIKDLSNVTSDGAWSSDWVLKWA
NT seq 2994 nt NT seq  +upstreamnt  +downstreamnt
atggggggtaagcttggtgtcacagttgctgcctttgccgcagcaattcttcacacaaca
tatgcgcaaagtccaacatctccacaatcgaataccactacaagttatcgttccgtttat
acacttccagcttcggttgatgtgagcgcacctgttatcccaaatatccaagatccgcaa
gcagtcaatgcgcaagatgtttgtccgggctatacggcatcagatatcaagcgaactcat
tacgggtggacggcattcttaacattagctggcgatgcctgcaatgtctacggaacggat
gtggattctctcaatctgacagtagaatatcaatcgaaagatcgtcttcacgtggagatc
gttcctacttatgttggaccttcaaacagctcttggttcattcttccagagtcccttgta
gagaagccctccattgatgccgacgcgaattctaccgctctggatagtgatcttagcttt
ttatggagcaatgatccaaccttttcgttttcaatctttcgtcaatccacaggcgatgtt
ctcttctctacagagggttctaaattaatttacgaaaaccaatttatcgaatttattagt
tccttgccagaaaattacaatctttatggcttgggggaatctatccatggatttcgtatg
ggcaataactttactcgtactttctgggccgctgatgttggtgataatattgacgcaaat
atttacggcaatcatggaatttatcttgacacaagatactacgaggttgatgcaagtact
ggaaacatgacatatgtcgcaaatgcaacaaatgtcactgcagactacgtttcctacact
cacggtgtctatcagcgaaatgcccatggccaggaagtcttgatgaaaccatcaaatatc
acttggaggactctcggtgggagtattgatctttatttctatgctggtccaacacaagaa
aaagtcaccaaagcatatcaaatgagtgcaattgggctcccagcgatgcaacaatatttt
acctttggatatcatcaatgtcgatggggctacgcaaactggactgaacttggcaaagta
gtagacaattttgcaaattttggtctcccgttagaaacgatctggttggatattgattac
atgaatcaataccgtgactttgaagtcgatgaagtcagatttggatattctgaaggtgct
gaattcatttcgaaacttcacggtaatggacaacatattgttccaattgttgactctgca
atctacattcctaatccagaaaatgaaactgatgcatacccgccttttaatcgtggcaat
gcaaccgacagttttatgttgaaccccgatggcagcttgtacataggaagtgtatggcct
gggtacacagttttccccgattggattggatccgtgttgaatggcactggagcacatcaa
tggtggtcagacgaactgacggcatggcattcaaacttttcattcgatggaatttggatt
gacatgagcgaagtctcttctttctgtgttgggtcatgcggtagcgataatcttactctc
aatcccgtccatccaccgttccttctaccgggcgaaccagggaatatcgactttatctac
ccagaaggatttaatcttactaatgctactgaagccgcagctgcatcttcttcttcagcc
agtcagtcctccgcttacgctacatcatcagcgtcatcatcgtctcaatccacaagttac
atccgcacaacgcccacaccaggagtccgcgatatagtttaccctccgtataccatcaac
aatttcttaggttcattagatgttcatgccgtctcaccaaatgcaacacatcacggtgga
actcaagaatatgactatcataatttgtttggacaccaaattttgaatgcaacttacaac
gccctcctaaatgtctctccatccaaacgtccatttatcattggtcgttctacttttgca
ggatccgggaaatgggctggacattggggtggcgacaactattctctgtgggcctacatg
ttcttctccattccccaagctctgtcgttctctttattcggaattcctatgtttggtgca
gacacatgtggtttctctggcaattctgacgaagagctctgcaaccgctggatgcaagtc
tctgcctttttccctttttacagaaatcataacactttagccgccccctctcaagaacct
tatgtgtgggcatctgtcatcgatgcaactaaggcagccactacaatcagatatactctc
cttccatatatttatactacgttctatatggctcattctactggatcaaccgtcatgcgc
gctctcgcctgggaatttcccaatgaccccactctagcgtctgcggatcgacaattctta
cttggcccaaatatcatggtcacacctgtattagaacaaggcgctactaccgtcgacggt
gtattccctggatcaggaaaagggcaggtctggtatgattggtataatcaatctgctatc
acttcatctcctggtcaaaatatcacaattgacgcaccacttggtcatattcctgtttac
attcggggtggttccattcttccgattcaagagcctgcattgacgactcaagaatgtaga
aataatccatggggcttgttggttgcatccagcttagaaggaactgctattggtgaactt
tacctagatgatggagaatctctggctccaaatgctactctttgggtcgatttctcaatg
acgcagaattcgctatacgcatcaggtcgaggtagttatattgacaataatccacttgca
aatatcaccatcatgggtattttgtcaagtgtcagtaacgtcacattgaatggtgttagt
ctcactagtggatggatgtataattctaccagccaggtccttgacatcaaagatttatcc
aacgtcacgagtgatggagcttggagtagtgattgggtgttgaagtgggcttga

DBGET integrated database retrieval system