KEGG   Botrytis cinerea: BCIN_12g01310Help
Entry
BCIN_12g01310     CDS       T01072                                 

Definition
(RefSeq) hypothetical protein
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
bfu  Botrytis cinerea
Brite
KEGG Orthology (KO) [BR:bfu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bfu03036]
    BCIN_12g01310
Enzymes [BR:bfu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     BCIN_12g01310
Chromosome and associated proteins [BR:bfu03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     BCIN_12g01310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hist_deacetyl RTP801_C
Motif
Other DBs
NCBI-GeneID: 5438455
NCBI-ProteinID: XP_001557854
LinkDB All DBs
Position
12:complement(join(453871..454938,454986..457499))
Genome map
AA seq 1193 aa AA seqDB search
MAYSSPNGGRNASPSPVQLPPSTSNNDAAISNSLRRLSISNSSRAGIPIPPHTSSSRATS
YGGHSNLYPSPSGRSPVLPSPLRRSSSTASFDQRRSSTSHLSRKPSLNSLNGGGLTPNKN
SISRRSSTQFAHRSPSVMGGKSLLSQREEDMREPSPRHTAASIASSHFKSELDLQDLNDG
SRSAETIVILHDSVYGHRFSRPKTSRTGLSTIVERPERIHASILGLSVAYVRLGERHSEG
RYPLHPGMEASAVPSTPFRIRKTTRRLSLSSQAITNVHGVKWMEELKIMCDNAEAKLAMN
GKELARPEMNRGPNEAPPSKFHEGDLYLCSESLDAMEGALGAVCEGVDAVFEGSSTGLGP
RRTFIAIRPPGHHCSASYPSGFCWLNNVHVGISHASLTHGLTHAAIIDFDLHHGDGSQAI
AWEHNARANNLAKNALPWKKTSIGYFSLHDINSYPCEMGDEEKVKNASLCIENAHGQNIW
NVHLQPWKSEEGFWELYESKYSVLLEKTRNFLRTQYDRLQTTPNGPKPKAAIFLSAGFDA
SEWESSGMQRHKVNVPTEFYARLTRDVVKLAAEEGTGVDGRIISVLEGGYSDRALCTGVL
SHLSGLSGSDPVAHTEKAFAGLNFEMGQRLGVDPLSPGPPSPYGFMPYDPLWWSQGRLEQ
LDAAMNSVPVPEEPKIQKPAGPQGNFASPTQSFIAKVVNTPTAQRSVSTMGMRNGVPVPR
SSPPRPPTPPPPDVHWTVAAHELSKLLIPTDRQTKSCQWEDLAAEATKARKERQSLANSE
GAQQPAMPEPANARMSLRTRKPPPKLLDSIEKDEVKKPAAKSNRRRTVPSTAASPVHKAP
PAPSTSQASDTNSSQSTQKTPRRLSAASISTTVAMPPPPRPAPAANKAPSSSQRPGSSMS
VRPGSAMSSRGPPPPPVVVKKTRAPAKPRTDASKPGPGRPRKKSPPVTDSDSNTNSTIGA
VPTAGNSNQSSDVDSLTSGMKKIKISLLTKAQKEAKEEEKHRVKVESSQADGKTFSNISN
ETPSTTANSETTYNQSAASTPIMSISPGPSTPQLSVPPHDHAQSEEPEQLPFPTSSPIAH
PLESYDSGNVSDHSSNYSADKFVAFQPHGPIPSTIEQQEPLRWLPPNTNTPASGKKYDLP
VFTSTSAIPFAPNSDGDNQTEFSNPHLEQDSSPSESTQLASSIWDIPVTPRDQ
NT seq 3582 nt NT seq  +upstreamnt  +downstreamnt
atggcatattcatcgccaaacggtggcagaaatgccagcccttcgccagtccagttgccc
ccctcgacaagtaacaacgatgctgcgatatcaaattcactgagacgcctttcaataagc
aactcttcaagagctggcattccaattccacctcatacttcttcctcgagagcgacatca
tatggtggtcattcaaatctctacccatcaccaagtggtagaagccccgtgcttccaagc
cccttacgccgaagttccagtactgcgagtttcgaccaacgtcgctcatctacttcacac
ctctctcggaaaccgtctttaaactcactcaacggcggaggtttaaccccaaacaaaaat
tcaataagcagaagatcatccacacaatttgcacataggtcaccatctgtcatgggtggg
aaatcactcctctctcaaagggaggaagacatgcgtgaaccttcaccacggcatactgca
gcatctatcgcaagttcgcacttcaagtcggaattggatttacaagatttgaatgacggt
tcaagatctgcagagactatcgtcatcctccacgactccgtttatggacatcgcttctcc
cgacccaaaacttcacgaactggtttgagtacaattgtcgaaagacccgaaagaattcat
gctagcatacttggattgtctgttgcatatgtgcgactgggtgaaaggcactctgaaggt
cgctatcctcttcaccctggtatggaagcttctgcggtacctagtacgccctttcgcata
cgcaaaactacacgtcgattgtctttatcgtcgcaagcgatcacaaatgtacatggagta
aagtggatggaggagttgaagatcatgtgtgataatgcagaagccaagctcgctatgaat
ggaaaggaattggctaggcctgagatgaatcgaggtccaaatgaagcacctccttcaaag
tttcacgagggcgatctctatctgtgttcggagtctttggatgctatggagggtgcgctg
ggtgctgtatgtgagggtgttgatgctgtctttgaaggctcttctaccggattaggacca
cgccgaaccttcattgcgataagacctcctggacatcattgttcagctagttatccttct
ggtttttgttggctaaataatgttcatgttggcatttcacatgcttcgctcactcacggt
ttaactcatgcggctatcatcgattttgatctccatcatggtgatggatctcaagcaatt
gcttgggaacataacgctcgtgctaacaacttggctaagaatgcattaccgtggaagaag
acctcgattggatattttagtcttcatgatattaattcgtatccatgtgagatgggtgac
gaggagaaagtcaagaatgctagtctttgtattgaaaatgcacacggccaaaatatttgg
aatgttcacctacaaccttggaaaagcgaagaaggattctgggaactatatgaatcaaag
tattcagtattacttgagaagacacgaaacttcttacggacgcaatatgatcgacttcaa
acaacgcctaatggacccaaaccaaaagctgccattttcttatcggctggtttcgacgcc
agtgagtgggagagttctggcatgcaacgtcataaagtcaacgttccaaccgaattttat
gctcgtctaacccgagatgttgtgaaacttgctgctgaggaaggtacgggggtagacgga
aggatcattagtgttcttgaaggtggttacagtgatcgtgctttgtgtaccggggtattg
agtcatcttagtggtttgtcaggaagtgatcctgtagctcacactgaaaaggcattcgcg
ggtctaaactttgaaatgggacagagacttggcgtagatccgttgagccctggaccgcct
tctccttacggtttcatgccatatgatccattatggtggtcgcaaggtcgattggaacaa
cttgatgctgctatgaacagtgtacctgtccccgaagagccgaaaattcagaaacccgcg
ggacctcaaggaaattttgcatctcctacacaatcctttattgctaaagtcgtcaatact
cctacggcacaacgtagtgtatcaacgatgggtatgagaaacggagtgccggttccaaga
tcttcacctcctaggccacctactcctccaccacctgatgttcattggacagtcgcagct
catgaattgagtaaattgcttattccaactgatagacagacgaagagttgtcaatgggaa
gatcttgctgccgaagccacaaaagcaagaaaagaacgtcaatcattagcaaactctgaa
ggtgcccaacaacctgccatgccggaaccggctaatgctagaatgtctttacgaacaaga
aaacctccaccgaaattgcttgatagtattgaaaaagatgaggtcaagaagcctgctgca
aaatcaaaccgtcgaagaaccgttcccagcaccgccgcttcacctgtacacaaggctcct
cccgctccaagcacaagtcaagcatccgacacgaattctagtcagtcaacacaaaagact
ccccggagacttagcgccgcatctatatccactactgtggcaatgcctccccctcctcgg
ccggcacctgctgctaataaggcgccatcatcttctcaaaggcctggtagttctatgagt
gtacgaccggggtccgctatgagttctcgtggacctcctccaccacctgtcgttgtcaag
aaaacaagagcaccggctaagcctcggactgatgcttcaaaaccaggtccaggtagacct
cgcaagaagtctcctccagtgactgattctgatagtaatacgaacagtactattggggct
gttccaactgcgggaaacagcaaccagtcttctgacgtcgatagtctaacttctggcatg
aaaaaaatcaagatcagtcttctgactaaagcacagaaagaagccaaggaagaagaaaag
catagggtaaaggttgaatcaagtcaagcagatgggaaaacattctcaaatatttcaaac
gaaacaccatctacaaccgccaattctgagacgacctacaatcaatctgcagcttccaca
ccaataatgagtatctcacctggaccttcaacccctcaactatctgtccctccacatgat
catgctcaatcggaagagcctgaacaactccccttccctactagctcacctattgctcac
cccttggagtcatatgattctggaaatgtttcagatcattcatcaaattacagcgcagac
aaatttgtggcttttcagccccatggcccgattccaagcacgatagaacaacaagaacca
cttcgatggttaccaccgaatacaaacacaccagcttcagggaagaaatatgaccttcca
gtatttacttccacgtccgccataccttttgctccaaattccgacggcgacaatcaaacc
gaattttcaaacccacacctcgaacaagattcatccccatctgaatctacacaattagct
tcttcaatctgggatattcctgttacaccacgggatcaatag

DBGET integrated database retrieval system