KEGG   Botrytis cinerea: BCIN_13g00240Help
Entry
BCIN_13g00240     CDS       T01072                                 

Gene name
Bccdc9
Definition
(RefSeq) Bccdc9
Organism
bfu  Botrytis cinerea
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 5427989
NCBI-ProteinID: XP_024552416
LinkDB All DBs
Position
13:join(126274..126299,126385..126626,126687..127884,127932..128700,128754..129290)
Genome map
AA seq 923 aa AA seqDB search
MPPKQATLGKFFGQPKGAPAKQSKLSFSSKPSSSKPPASSPSASEASEENKDVEMKDGDS
DIGNEDSIKKEDGSDKKQKVKKENAKLEKGVKRSRSASPKLSAKTKAIKIEDEVKEEEEE
EDEDEEPIVKKPRRAGKAETREKKPSPKPVSMKTQTKPEPESSTKKATSKNMSPPPKRGK
NAKVVEEDEEDEDEVQATAPSKPAKRRDSNVSKSASESEIEEDLESSGDEKPEVAAKARE
KIQTSLKSKSKDPYPDWKPGEPVPYAALCTTFSLVEMTTKRLVIAAHCSLFLRQVLRLTP
DDLLPTVLLMINKLAADYAGIELGIGESLIMKAIGESTGRNLSVIKNDQKEIGDLGLVAV
KSRSNQPVMFKPKPLTIRGVLKSLIDIATMQGNGAQGRKVDGIKKLLSAADAHSSGKVDI
TKDKGGASEAKYIVRFLEGKLRLGLAEKTVLVSLAQAMVCHEIEAKGSGKVPSTEQMAKG
ESILKAVHSSLPSYDVIIPAMLEHGIFNLKDNCKLQPGVPLKPMLAKPTKAITEVLDRFE
NQTFTCEYKYDGERAQIHYVSKDSSKQYLGATPAAAKSSDGGLAAIFSRNSEDLSKKYPD
ILGKLNTWVKEDTKSFVLDCETVAWDTVEKKVLPFQQLMTRKKKDVKVEDVKVKVCVFAF
DLLFLNGEAVVEKSLRERRALLHEAFQPVEGEFQFATSMNGQEIDEIQTFLDDSVKASCE
GLMVKMLDGTESGYEPSKRSRNWLKIKKDYLSGIGDSLDLVVLGAYYGRGKRTSVYGAFL
LACHNPQTDTYETICNIGTGFSEQVLEELYAQLSAIVIDRPKPFYSHSSGNQHQPDVWFE
PRYVWEVKTADLTLSPRYKAGCKEGVDKGGERGISLRFPRFIKIRDDKKPDMATSSRQVA
EMYRKQESVTKNKGPSVDDDFEY
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgcctccaaagcaggcgacattgggcaagttcttcggccaaccaaaaggtgcgcctgca
aaacaatcgaagctatctttctcttccaagccaagctcaagcaagccgccagcaagctcg
ccatccgcgtcagaagcctcagaagagaataaagatgttgagatgaaagatggagattca
gatataggaaacgaagattcgatcaagaaagaagatgggtctgataaaaagcaaaaagta
aaaaaagaaaatgcaaagttagagaaaggtgtgaagagatcaagatccgcgagtccgaaa
ctctcagcaaagactaaggctataaaaattgaggatgaagtcaaggaagaagaggaggag
gaggatgaagacgaagagcctattgtgaagaagcctcgaagagctggaaaggccgaaaca
agagagaagaagccttcgccaaaacccgttagcatgaaaactcagaccaaacccgagcca
gaatcatcgaccaaaaaagccacttcaaagaacatgtcaccgccaccaaagcgtggtaag
aacgccaaggtagtagaggaagatgaagaggatgaagacgaagtgcaagcaacagcacca
tcaaaaccggcaaagcgcagagactcaaatgtatccaaatcggcatcagaatccgaaatc
gaggaggatttagaatctagtggagacgagaaaccggaagtagctgccaaagctagggag
aagattcaaacatccttgaaatcgaagagcaaagacccatatccggattggaaaccagga
gagccagtaccttatgcagctctttgtacaacattctccctggtagaaatgacgaccaag
cgattagtaattgcggctcattgttccttgtttcttcgtcaagtccttcgacttacccca
gatgatcttttacctacagttcttctcatgatcaacaagttggctgcagattatgctgga
attgagttgggtattggtgaatcattaattatgaaggccatcggagagtctactggtcga
aatttaagcgtcatcaagaatgatcagaaagagattggtgatcttggacttgtagctgtt
aagagtcgatcaaatcagcctgtaatgttcaagccaaagccattgacaatcagaggcgtt
ctgaagagtctgatcgacattgctacaatgcaaggcaacggtgcccagggacgaaaagtt
gatgggatcaagaagttgctttccgcagctgatgcgcattcgtcaggtaaagttgacatc
acaaaagacaagggtggagcaagcgaagcaaaatacattgttcgtttcctagagggtaag
cttcgtcttgggttggcagaaaagaccgttctcgtgtctttggctcaagcaatggtatgt
catgagattgaagcgaaaggttctggaaaggttccaagcacagaacagatggcgaaggga
gagtcgatattgaaagcagttcacagctcccttcctagttatgatgtgatcattccagca
atgttggagcacggcatcttcaacctgaaagataactgcaagctccagcccggtgtacca
ttgaagcctatgttggccaaaccaacaaaagcaataacagaagtcctggatcgatttgaa
aatcaaactttcacttgcgagtataaatacgatggagaaagagcccagatacattacgtt
tctaaggattcttccaaacaatatcttggtgctacacccgctgctgctaaatcgtctgat
ggaggccttgctgctatattctcacgaaactcagaagatctttccaagaaatacccagat
attcttggcaaactaaacacatgggtcaaggaagatacgaagagctttgtactcgattgt
gaaacggttgcttgggatacggttgaaaagaaagtcttgcctttccaacaactcatgaca
cgaaagaagaaggatgttaaggttgaagatgttaaagttaaagtttgtgtgttcgccttc
gatttactttttctgaacggtgaagctgttgttgagaaatcattacgagaacgtcgtgca
cttctccatgaagcttttcagcctgtcgaaggcgaatttcaatttgctactagtatgaat
ggccaagagattgatgagattcagacattcttagatgatagtgtcaaggcatcgtgcgaa
gggttgatggtgaagatgttggatggcacggaaagtggttacgagcccagtaaaagaagt
aggaattggcttaagatcaagaaggattatctctcaggcatcggcgattctctcgatctc
gttgttctaggagcctactatggtcgtggaaagcgtacttccgtctacggagctttcctc
ctcgcctgtcacaaccctcaaactgacacctacgaaactatctgcaacattggcactggt
tttagcgaacaagttctcgaagaactctacgcccaactctctgctatagttattgaccgt
cccaaaccgttctactcccattcctcaggaaatcaacatcaacctgatgtttggtttgag
ccaagatatgtctgggaagtcaagacggctgatttgactttgagtccgagatacaaggcg
ggttgtaaggagggcgtcgacaaagggggagaaaggggcatttcgttaagattcccaaga
tttatcaagattagagatgataagaaaccggatatggcgacgagtagcagacaggttgcg
gagatgtacaggaagcaggagagtgttacgaagaataagggcccgagtgttgatgatgat
tttgagtattag

DBGET integrated database retrieval system