KEGG   Botrytis cinerea: BCIN_13g01610Help
Entry
BCIN_13g01610     CDS       T01072                                 

Definition
(RefSeq) hypothetical protein
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
bfu  Botrytis cinerea
Pathway
bfu00220  Arginine biosynthesis
bfu00250  Alanine, aspartate and glutamate metabolism
bfu01100  Metabolic pathways
bfu01200  Carbon metabolism
bfu01210  2-Oxocarboxylic acid metabolism
bfu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bfu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BCIN_13g01610
   00220 Arginine biosynthesis
    BCIN_13g01610
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bfu01007]
    BCIN_13g01610
Enzymes [BR:bfu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     BCIN_13g01610
Amino acid related enzymes [BR:bfu01007]
 Aminotransferase (transaminase)
  Class I
   BCIN_13g01610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-GeneID: 5437622
NCBI-ProteinID: XP_001557050
LinkDB All DBs
Position
13:complement(join(583901..584952,585011..585419))
Genome map
AA seq 486 aa AA seqDB search
MSTTTALRSLNINNINPHVKEAKYAVRGALAVKSEEYRAKLAKGDKDLPFDAVISANIGN
PQQLDQQPITFFRQVLSLLEYPPLLEKEDVLLNGLGYKKDVIERARWLLKEVGSVGAYSA
SAGATGIKDSVARFIENRDGFPADPKDIYLSAGASAGVNTLLHVICAGPNTGVLVPIPQY
PLYTASLSVLNAKCVPYYLDEARNWGTDLQAIKDAYAAAVKEGTDVRAIVIINPGNPTGA
SLPPQDIEEVIKFAAEKKLVVMADEVYQTNVFKGKFHSFKQILRDLQSKTPEKYDNVELA
SLHSISKGMVGECGHRGGYFELCGFDPEVVEQIYKFVSISLCAPVIGQCLVELMVNPPKE
GEPSYELYKKEYDGIFSGLQKRATALYEAFKQMEGVECPEPQGSMYLFPTIHIPEKAVEA
AKQEGMGPDEYYCHKLLEATGVCVVPGSGFGQRENTLHFRTTFLAPGTEWVGRITKFHEG
FMGEFR
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccactaccgctctccgcagtttgaacatcaacaacatcaacccacacgtcaaa
gaagccaagtatgctgtccgtggagccctcgctgtcaaatcagaagaatacagagccaag
cttgcaaagggcgataaggatcttccattcgatgcagtcatcagtgccaacattggaaat
ccgcagcaattggatcagcaacctattactttcttcagacaggtcttgagtttactcgag
tacccaccattgttggagaaggaggatgtattgttgaatgggttgggctataagaaggat
gtcatagagagagcgaggtggttgttgaaggaagttggaagcgtgggtgcttatagtgcc
agtgctggtgcgacgggaatcaaagacagtgtggctagatttattgagaatcgagatgga
ttccccgcagatccaaaggatatctacctctccgccggtgcctccgctggagtcaacacc
ctccttcacgtcatctgtgccggtcccaatacaggtgttctagtacctatcccacaatat
cctttgtataccgcctccctctccgtcctcaacgcaaaatgcgtcccatactatctcgac
gaagctcgcaactggggtacagacctccaggccataaaagatgcatatgctgccgctgtc
aaagaaggaaccgatgtcagagctattgttataatcaaccctggtaacccaactggtgca
agtctcccacctcaggatattgaagaagtcattaaattcgctgccgagaagaaattggtt
gtgatggcagatgaagtataccaaaccaacgtctttaaaggaaaatttcactctttcaaa
caaatccttcgcgatctccaatccaaaactccagagaaatacgacaatgttgaactcgct
tctctgcatagtatttccaaaggcatggttggcgaatgtggacatcgaggtggatatttc
gaactgtgtggtttcgatccagaagtcgtagaacagatatataagtttgttagtatcagt
ctatgcgcaccagttatcggacaatgtcttgtcgaactcatggtaaaccctccaaaagaa
ggcgaaccatcctacgaactatataaaaaagaatacgatggtatattttccggactccaa
aaacgcgcaacggctctctatgaagcattcaagcaaatggaaggtgtagagtgtccagag
cctcaaggaagcatgtatttgttcccaactatccacattccagaaaaggcggtagaggct
gcgaagcaagagggtatgggcccagatgaatattattgccataaattacttgaggccacg
ggtgtttgcgtggtgcctggaagtggtttcggtcaaagagaaaacacgctgcatttccga
acgacatttttggcgcctggtacggaatgggtgggcagaattacaaagttccacgaggga
tttatgggagagttcagatag

DBGET integrated database retrieval system