KEGG   Botrytis cinerea: BCIN_13g04300Help
Entry
BCIN_13g04300     CDS       T01072                                 

Gene name
Bcpet8
Definition
(RefSeq) Bcpet8
  KO
K15111  solute carrier family 25 (mitochondrial S-adenosylmethionine transporter), member 26
Organism
bfu  Botrytis cinerea
Brite
KEGG Orthology (KO) [BR:bfu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bfu02000]
    BCIN_13g04300 (Bcpet8)
Transporters [BR:bfu02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   BCIN_13g04300 (Bcpet8)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mito_carr Serine_protease
Motif
Other DBs
NCBI-GeneID: 5429162
NCBI-ProteinID: XP_001548672
UniProt: A0A384K1A2
LinkDB All DBs
Position
13:complement(1556170..1557027)
Genome map
AA seq 285 aa AA seqDB search
MSQSNFTPALLAGALAGTTVDLTLFPLDTLKTRLQSSAGFIASGGFTGVYRGVGSAIIGS
APGAALFFCTYEATKSAFAKRRDALDANIPGGRGTGRAIEHMAAASLGEIAACAVRVPTE
VVKQRAQAGQYSSSLLTLKAILGQYKHIGIVGVWKELYRGWSVTIMREVPFTIIQFPLWE
SMKAYRKRTSGRDTVNAVESGLMGSLAGAVAAAATTPLDVLKTRMMLEKQKKSTKVLLKE
IIAKGGPKAFFAGIGPRVMWISIGGAIFLGSYQWAYNELAKEVKE
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaatcaaacttcacccccgctctcctagcgggagccctcgccggtaccacggtc
gacctcacccttttccccctcgatactttaaaaacccgcctgcaatcctccgccggcttc
attgcctctggaggctttacaggagtatatcgaggagtcggttctgctataattggctct
gcgcccggagctgcattgttcttttgtacgtacgaagctaccaaaagcgcattcgcgaaa
cgacgggatgctttagatgcgaatattcctggaggtcgcggaacggggagagcaatcgaa
catatggctgcagcgagtttgggagagatcgccgcttgtgccgttcgtgtgcctacggag
gttgtcaagcagagagctcaggcggggcaatattcaagctccttactcacgctcaaggcg
attctgggacaatacaaacacattgggattgtaggagtgtggaaggaactctaccgcggc
tggagtgttaccataatgcgggaagtgcctttcacaatcatacaatttcctctttgggaa
tccatgaaggcatataggaagagaacaagcggaagagatactgtgaacgcagtggagagt
gggcttatgggaagtcttgctggtgcagtggcggctgcggctaccactcctttggatgtg
ctgaagacgaggatgatgttagagaagcagaagaagtcgacaaaggttttgttgaaggag
ataatagctaagggtggtccaaaggcattcttcgcagggataggtccaagagtaatgtgg
atcagtattggaggagctatattcttgggtagctaccaatgggcatacaatgaattggct
aaggaggtaaaggaatag

DBGET integrated database retrieval system