KEGG   Botrytis cinerea: BCIN_15g01180Help
Entry
BCIN_15g01180     CDS       T01072                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
bfu  Botrytis cinerea
Pathway
bfu00020  Citrate cycle (TCA cycle)
bfu00190  Oxidative phosphorylation
bfu01100  Metabolic pathways
bfu01110  Biosynthesis of secondary metabolites
bfu01130  Biosynthesis of antibiotics
bfu01200  Carbon metabolism
Module
bfu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bfu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bfu_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:bfu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCIN_15g01180
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BCIN_15g01180
Enzymes [BR:bfu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BCIN_15g01180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 HI0933_like DAO
Motif
Other DBs
NCBI-GeneID: 5434242
NCBI-ProteinID: XP_024553221
LinkDB All DBs
Position
15:join(453015..453056,453153..453207,453263..453336,453391..453719,453773..454996,455056..455275)
Genome map
AA seq 647 aa AA seqDB search
MSSFAMRRFTSGPSFSKALKNQTRSFSSTRPAARIITHAPLRAKEASPFVSNKYPVVDHE
YDAIVIGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDDWRW
HMYDTVKGSDWLGDQDAIHYMTREAPASVIELENYGCPFSRTDDGKIYQRAFGGQSQKFG
KGGQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEYFALDLIMEDGECKGVIAYNQED
GTLHRFRAHNTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGIY
GAGCLITEGARGEGGYLLNSQGERFMERYAPTAKDLASRDVVSRSMTMEIRDGRGVGPDK
DHIYLQLSHLPPDVLHERLPGISETASIFSGVDVTKQPIPVLPTVHYNMGGIPTKYTGEV
LTVDAEGKDQVVPGLFACGEAACVSVHGANRLGANSLLDLIVFGRAVSHTIRDNFEPGMP
HKEISADAGAESISVLDQIRTADGTKSTHDVRLAMQKTMQTDVSVFRTQESLDEGVTKIN
AVDQTFKDIKTQDRSMIWNSDLVETLELRNLLTCAVQTAEAAAARKESRGAHAREDYPER
DDKEWMKHSLTFQKKPQGKTDLTYRAVVGHTLDENECKAVPPFKRVY
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcatttgctatgcgtagattcacatctggtccttcgttctcgaaggcattgaag
aatcaaactagatctttctcatcgacgagacctgcagctcgaatcattacacatgcgcca
ctgagagcaaaggaagcttcgcctttcgtgagcaataagtacccagtcgttgatcacgaa
tatgacgctattgtcatcggtgctggaggagcaggtttaagagcagcattcggtcttgcc
gaggctggtttcaacactgcatgcatatcaaagcttttcccaacccgatcacatacagta
gccgcgcaaggaggtatcaatgctgctctgggtaacatgcacgaggacgattggagatgg
cacatgtacgataccgtcaagggttcagattggttgggagatcaagatgctattcactac
atgacaagagaagcgccagcatctgtcattgagttggagaactacggttgcccattttca
agaactgatgacggcaagatctatcaacgtgctttcggtggtcaatcacaaaaattcgga
aagggtggacaagcatacagatgttgtgcagcagctgacagaactggacatgcacttctc
cacactctctacggtcaatctttaagacataacacaaactacttcatcgaatatttcgca
ctcgacttgatcatggaggatggagaatgtaagggtgttattgcatacaaccaagaagat
ggtaccctccacagattccgcgcacacaacactgtcttggccaccggtggttacggacgt
gcctacttcagttgtacatccgcacacacttgtactggtgatggaatggctatggttgct
cgtgccggattacctaaccaagatcttgaattcgttcaattccatcctactggtatttat
ggcgctggttgcttgattactgagggtgctcgtggtgagggtggatatctcctcaactcc
cagggtgaaagatttatggaacgttacgcaccaactgccaaggatttggcttcccgtgac
gttgtctctagatcaatgaccatggaaatcagagatggacgtggtgttggtccagacaag
gatcacatctatctccaactcagtcatcttccacctgatgttctccacgagcgtctccca
ggtatctctgagaccgcatccattttctctggtgtcgacgttacaaagcaacctatccca
gttcttccaacagtccactacaacatgggtggtattccaaccaagtacactggtgaggtt
ctcactgttgatgctgagggtaaggatcaagttgtaccaggtctcttcgcatgtggtgaa
gctgcttgtgtttccgtacacggtgccaaccgtcttggagccaactcacttcttgatttg
attgttttcggtcgtgctgtatcccacactattcgcgataacttcgaaccaggaatgcca
cacaaggagatcagtgccgatgctggtgctgaatctatcagtgttcttgaccaaattaga
actgctgacggtaccaagagcacacacgatgttcgtctagccatgcaaaagactatgcag
acagacgtcagtgtgttcagaactcaagagagtttggatgagggtgtcaccaagattaac
gctgttgaccaaacattcaaggatattaagactcaagacagaagcatgatctggaactcg
gatttggttgagactttagaattgaggaacttgttgacttgcgctgttcaaaccgccgag
gcagctgccgccagaaaggaatctcgtggagcacatgcccgtgaagattacccagagaga
gatgacaaggaatggatgaagcattctttgaccttccaaaagaagccacaaggaaagact
gatttgacctacagagctgtcgtaggccacaccttggatgagaatgagtgcaaggctgtc
ccacctttcaagcgtgtatactaa

DBGET integrated database retrieval system