KEGG   Brevibacterium flavum ZL-1: C628_02825Help
Entry
C628_02825        CDS       T04445                                 

Definition
(GenBank) transcriptional regulator
  KO
K09684  PucR family transcriptional regulator, purine catabolism regulatory protein
Organism
bfv  Brevibacterium flavum ZL-1
Brite
KEGG Orthology (KO) [BR:bfv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bfv03000]
    C628_02825
Transcription factors [BR:bfv03000]
 Prokaryotic Type
  Other transcription factors
   Others
    C628_02825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PucR HTH_30 HTH_8 Phage-MuB_C Robl_LC7 HTH_23 HTH_17
Motif
Other DBs
NCBI-ProteinID: ANR61553
LinkDB All DBs
Position
complement(608264..609778)
Genome map
AA seq 504 aa AA seqDB search
METPTQDMDVRWLYTQSQLKLREILPTNKTFDVIQISELVDPTDFISPNSVVLSVGIAFA
ETPDGLRDWAHRLAAAGVVAIGFGSGLTFPQVPQALIDASLHLGLGLFEVPREIPFISIT
SSVRDEQTRRAGRLQQELLLEQERLNSIAISGGIEALCRAAADYLGGAVTIVDSDGRVAC
SITTDDLDALPQAVSRLNGSSQALTDATNFGFIHRMTRYGDRHHVLSVLMPTRPTDQHRA
LIRHCAGLADILLQRPEAMRDREIEVRSLAMSLLLGRSDDLATIHRVFADITDASGNIRP
ILITGNTPQSVRKALSSVATALYKQERALAHLRLAESTELLFLRGSRSVHNIVQLFGTAA
SGVRLCIGLPTRAENIDKKLIRELTATAKTLQLGTHAEPRDGTLLWLQNPELRKILKIRS
RDTYDRLLDHDRTNNTELAPTLVSFTQHSGHIGDTAKELGIHRHTVRTRMIRIEEICEID
LNDPLTRAELLLVIATKEGDVEKH
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccccaacccaagacatggatgtccgctggttatacacccaaagccagctcaaa
ctccgcgaaattctccccacaaacaaaaccttcgatgtcatccaaatcagcgaactcgtt
gaccccaccgacttcatcagccccaacagcgtggtcttatccgttggcatcgccttcgca
gaaacgcccgacgggcttcgcgattgggcacaccgactcgccgccgcaggggtcgtcgcg
atcgggttcggctccggcctcaccttcccacaggttccgcaggcgcttatcgacgcctcc
ctccaccttggcctcggcctctttgaagtcccccgtgaaattccatttatctcgatcacc
tccagcgtgcgtgatgagcaaacccgccgtgccggccgcctgcaacaagaactcctcctg
gaacaggaacgacttaactccatcgccatctccggtggcatcgaagccctgtgccgtgct
gccgccgactatttgggtggtgcagtaaccatcgtggacagcgacggccgcgtggcttgc
tctattaccaccgatgacctagacgcactcccccaagctgtctcgcgcctgaacggatcc
agtcaagcactcacggatgccaccaactttggattcatccaccgcatgacccgctacggc
gaccgccaccacgtgctctcagtccttatgcccacccgccccacagaccaacaccgcgcg
ctgatcagacactgcgcaggccttgccgatattttgctccaacgccccgaagccatgcgc
gaccgagaaatcgaagtgcgatcacttgccatgtcactacttctgggtcgaagcgacgac
ctggccaccattcaccgcgtgttcgctgacatcactgatgcttccggaaatatccgcccc
atcctcatcaccggcaacacaccccaatcagtacgaaaagcactctccagtgtcgccacc
gcactgtacaaacaggaacgagcactagctcatctacgcctcgccgaatccaccgaactc
ctcttccttcgcggaagccgcagcgtgcacaacatcgtgcaactttttggtactgccgca
agcggagttcgcctctgcattggtctgcccacccgagcggaaaacatcgataagaaactc
atccgcgaactcactgccaccgcaaaaaccctacaacttggaacccacgccgaaccccgt
gacggcaccttgctgtggctccaaaaccccgagctgcgcaaaatccttaagatccgatcc
cgcgacacctacgaccgtctcctcgaccacgaccgcaccaacaacaccgagctcgccccc
accttggtgtcttttactcagcacagcggacatataggcgacaccgccaaagaactgggc
atccaccgccacaccgtgcgcacccgcatgatccgcattgaagagatctgcgaaatcgac
ctcaatgatccactgaccagagcggagctgctcttagtgatcgcaacgaaggagggagac
gtcgaaaagcattaa

DBGET integrated database retrieval system